PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K00813.1.p
Common NameMIMGU_mgv1a022416mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Dof
Protein Properties Length: 357aa    MW: 38115.2 Da    PI: 8.7028
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K00813.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-393291362
            zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                      e alkcprCds ntkfCyynnysl+qPr+fCk+CrryWt+GGalrnvP+Ggg+rknkkss
  Migut.K00813.1.p 32 EPALKCPRCDSPNTKFCYYNNYSLAQPRHFCKTCRRYWTRGGALRNVPIGGGCRKNKKSS 91
                      6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.8E-333489IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-253586IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3483589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MIMSPANNKP AAGKDDRRTP SSAAAAARPP QEPALKCPRC DSPNTKFCYY NNYSLAQPRH  60
FCKTCRRYWT RGGALRNVPI GGGCRKNKKS SKSSSSPRLS TGGDSMDNSG GSGRDGNGGL  120
KFFQGISPAM DFQLGGGSAA AAAMMINFPA APLFNQFSHF GDLSNTCGAI SSTPCFTAFD  180
PSATTSSPPL MGFNFPFSSP LIKQGENNFQ SNLASSIESL SSINQDLHWK LQQQRLSMMF  240
VGDHHHHQRE NNAAVAPPPS NIGTLNLAQK PQPILFQNLD VSKADESCGA GTQRRSDHCG  300
GGNQNLSTEW FFDNSSYAAV TPTPASSGSN VNDQNNSGNW SNLQAWSDLN QYASLP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.K00813.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012853750.10.0PREDICTED: dof zinc finger protein DOF5.7
TrEMBLA0A022Q7X50.0A0A022Q7X5_ERYGU; Uncharacterized protein
STRINGMigut.K00813.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-46Dof family protein