PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K00443.2.p
Common NameLOC105960644, MIMGU_mgv1a014582mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family YABBY
Protein Properties Length: 142aa    MW: 16222.3 Da    PI: 10.5986
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K00443.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY136.24e-423411391170
             YABBY  91 sastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                       s+s+ +++++++ +   ++p++  v+rPPekrqrvPsayn+fikeeiqrika+nP+ishreafs+aaknWahfP+ihfgl
  Migut.K00443.2.p  34 SSSKLNNKMSIQPSIPTKLPEQRTVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGL 113
                       344444444556777889999999******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.3E-4023113IPR006780YABBY protein
SuperFamilySSF470955.63E-857106IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.0E-460107IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MASTFHPFWP DHHLLHQAPN YNSSSEYKVD LGGSSSKLNN KMSIQPSIPT KLPEQRTVNR  60
PPEKRQRVPS AYNQFIKEEI QRIKANNPEI SHREAFSTAA KNWAHFPHIH FGLMLETTNQ  120
TAKLNEGSEK HKMRRAAIVN K*
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.K00443.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012840285.11e-102PREDICTED: axial regulator YABBY 5
SwissprotQ8GW464e-43YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A022R5T51e-100A0A022R5T5_ERYGU; Uncharacterized protein
STRINGMigut.K00443.1.p1e-101(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.22e-45YABBY family protein
Publications ? help Back to Top
  1. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]