PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K00262.1.p
Common NameMIMGU_mgv1a020062mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family CO-like
Protein Properties Length: 373aa    MW: 41066.9 Da    PI: 7.6685
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K00262.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box192.8e-062254436
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                      + C+ +++  + lfC+  + ++C +C  + H+ 
  Migut.K00262.1.p 22 KPCDYCNSTAALLFCRAESAFMCMSCDAKLHSA 54
                      68******99******************99965 PP

2zf-B_box248.1e-0867108338
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 
                        ++C+ +++ ++   C+ +   lC +C   +H+       H+
  Migut.K00262.1.p  67 VWMCDVCQQAPAAVTCKADAAALCVTCDRDIHSAnplarrHE 108
                       689*****************************6566766776 PP

3CCT68.12.3e-23299342144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       R+a++lRYkeKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Migut.K00262.1.p 299 RKARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 342
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.2571969IPR000315B-box-type zinc finger
SMARTSM003360.651954IPR000315B-box-type zinc finger
CDDcd000211.87E-72369No hitNo description
SMARTSM003369.3E-1565112IPR000315B-box-type zinc finger
PROSITE profilePS501199.96865112IPR000315B-box-type zinc finger
PfamPF006434.3E-667109IPR000315B-box-type zinc finger
CDDcd000214.41E-968110No hitNo description
PfamPF062031.5E-17299341IPR010402CCT domain
PROSITE profilePS5101716.559299341IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MTQLDGGGGK YFPAGWNVAA AKPCDYCNST AALLFCRAES AFMCMSCDAK LHSADDKPAA  60
ARRHERVWMC DVCQQAPAAV TCKADAAALC VTCDRDIHSA NPLARRHERA AVVPFYDTAE  120
SMVPMKSSTP SSTAAALSGG DSHRKLDNST ILNDYFPDSW ISSEPFVTTK LPADNPAMDF  180
FFSDSDQLLN FDNYQIFSSN PFNDSVVPVQ TTVKPPVQAQ LIHKQPPENR FEIDFTRSNI  240
TSYTNQKFQA TSSSTDVGIV PDVSSGGVSE TTSYPFATTS VKSENYDPIP IRSINHVDRK  300
ARVLRYKEKR KNRKFEKTIR YASRKAYAET RPRIKGRFAK RTEYDSDADE IFSSGAGSNF  360
FADAGYGVVP SF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.K00262.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012841066.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLA0A022R0P70.0A0A022R0P7_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.16e-81CONSTANS-like 5