PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H00048.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family FAR1
Protein Properties Length: 853aa    MW: 97842.6 Da    PI: 6.2967
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H00048.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR173.73.9e-23173260190
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       k+Yn+YA + GFs+rk+  ++sk +g +++r+++C ++g+ ++++++  + +++r etrtgC a+++++++++gk++v+++e  HnHel+
  Migut.H00048.1.p 173 KCYNRYALMEGFSIRKDFVNRSKVTGFVVSRRYTCHRQGYGSTKRDA--NVNKPRRETRTGCLAHMTITRQTNGKYRVIHFERRHNHELV 260
                       58***************************************999888..8999***********************************97 PP

2FAR188.78.2e-28309397190
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       +fYn+YA +vGFsvrk++ ++sk +g + +r+++C +eg+r+++k+  +k +r+r+etr+gC a+l++++++dg++++t++e+ HnHel+
  Migut.H00048.1.p 309 EFYNAYAARVGFSVRKDYVNRSKVDGAVASRRYTCFREGYRQNDKRG-SKVKRPRKETRVGCMAQLVISRQSDGRYRITHFEERHNHELV 397
                       6*******************************************999.99**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.5E-21174260IPR004330FAR1 DNA binding domain
PfamPF031017.7E-25309397IPR004330FAR1 DNA binding domain
PfamPF105513.9E-28518612IPR018289MULE transposase domain
PROSITE profilePS5096610.484797833IPR007527Zinc finger, SWIM-type
SMARTSM005754.7E-6808835IPR006564Zinc finger, PMZ-type
PfamPF044341.1E-4810832IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MDTSLDAEVQ GTSKDDVREK VDPTSLVDAD MNQISEAHNL SYDADVAFVH EQTSVSQEAS  60
SAEKDGMDMD SESTYSCFNS SSDEKSIDSV AAHELTTHNS DHNGLNKDRE YENRSSKTSS  120
SDNDHSPGTS SNNQPASTFD ALSGSVQVVE DGIGEYVVPN LGVEFEAEEH AYKCYNRYAL  180
MEGFSIRKDF VNRSKVTGFV VSRRYTCHRQ GYGSTKRDAN VNKPRRETRT GCLAHMTITR  240
QTNGKYRVIH FERRHNHELV TPFTAHLLPA QKRISFVETV EAESDVATSV PDGVPKLGMG  300
FDSEDLAYEF YNAYAARVGF SVRKDYVNRS KVDGAVASRR YTCFREGYRQ NDKRGSKVKR  360
PRKETRVGCM AQLVISRQSD GRYRITHFEE RHNHELVHAC KVRMLRSQKR SMTNQNGESS  420
PYGGAEMQPK SLAELLLTGV GIEDDFYDPI DHEMRLTSKR AYYMKQEEAE SLNLYLQSKK  480
LKDPSFVYCV QLDVEEEMTN FFWADEKMLV DYGDFGDVVY FDSTYRLNKD WRPLVLFFGI  540
NNHKQILVFG AAFVYGDTSE SFKWLFRTFV KAMSGKTPKT ILSDREAAIT EAIVSELPET  600
HHRLCTWQIY QNALKHLSQI GVNSDSFSSD LCGVFFNPEE EEFVNSWKVM LDTYGLWEND  660
LLHGIFEERE KWAVPYNKHI FAADIETALL SEGSITSVRK YLKPESHVLQ FVKHFGRVVN  720
EWRYKELEAN YDMGHHLPRL MGDVVMLKQV REVYTPVIFK MFHQEYENCL NNVINECIDT  780
ESSVEFKVST YGQVRQYTVL YSSENDSVVC SCMKFQFVGI LCSHALKVLD YRNIKIVPSQ  840
YILKRWTRKA RE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.H00048.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012850104.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2G9GNZ50.0A0A2G9GNZ5_9LAMI; Uncharacterized protein
STRINGMigut.H00048.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-99FAR1-related sequence 5