PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.F01969.1.p
Common NameLOC105955323, MIMGU_mgv1a025148mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WOX
Protein Properties Length: 241aa    MW: 27025.8 Da    PI: 8.836
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.F01969.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-203089357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      +R+++tkeq++ Le l+++  r+p+ae++++++ +l    +++ ++V++WFqN++a++++
  Migut.F01969.1.p 30 SRWNPTKEQINMLEGLYKQgLRTPTAEQIQQITVRLrdfgHIEGKNVFYWFQNHKARQRQ 89
                      6*****************99**************************************97 PP

2Wus_type_Homeobox112.91.7e-363091465
  Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +RW+Pt+eQi++Le lyk+GlrtP++e+iq+it +L+ +G+ie+kNVfyWFQN+kaR+rqkq
   Migut.F01969.1.p 30 SRWNPTKEQINMLEGLYKQGLRTPTAEQIQQITVRLRDFGHIEGKNVFYWFQNHKARQRQKQ 91
                       8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-132496IPR009057Homeodomain-like
PROSITE profilePS5007110.5442590IPR001356Homeobox domain
SMARTSM003893.3E-42794IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.2E-83089IPR009057Homeodomain-like
PfamPF000463.3E-183089IPR001356Homeobox domain
CDDcd000861.31E-53191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEGGGGGGDH VQSSGGNGNG NGNGNGNGGS RWNPTKEQIN MLEGLYKQGL RTPTAEQIQQ  60
ITVRLRDFGH IEGKNVFYWF QNHKARQRQK QKQDTYAYFN RFLHHHPSPL FPLPYQNVGC  120
SPCYMAAPKN EGQLYHHYPK VLPIPAGNYS KRPTLIPGST SQSQRYNKPM HKNQEEHHHH  180
HQETLDLFPI HPTGILQSRS GRIEIDSNPC PSSSSDQNDG LNSDTNIQYP FFDFFCGKGN  240
*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.F01969.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834494.11e-180PREDICTED: WUSCHEL-related homeobox 2-like
SwissprotQ6X7K16e-45WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A022RL461e-179A0A022RL46_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-41WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  3. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]