PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.F01137.1.p
Common NameMIMGU_mgv1a001368mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family FAR1
Protein Properties Length: 863aa    MW: 99707.1 Da    PI: 6.3925
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.F01137.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR183.92.7e-2669155188
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                       +fYn+YA+ vGFs+rk+  ++sk +g++++r+f+Cs++g+r+++k++ ++ +++r+etrtgC a+++v+++ d k+ vt++e+ HnHe
  Migut.F01137.1.p  69 RFYNKYAELVGFSIRKDWVNRSKVHGRVMSRKFTCSRQGHRKKDKRD-VNVKKHRKETRTGCMAHMVVTRQADRKYIVTQFEEGHNHE 155
                       5*******************************************999.999************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.7E-2369155IPR004330FAR1 DNA binding domain
PfamPF105512.6E-20282373IPR018289MULE transposase domain
PROSITE profilePS509669.483562598IPR007527Zinc finger, SWIM-type
PfamPF044345.4E-4571597IPR007527Zinc finger, SWIM-type
SMARTSM005752.3E-5573600IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 863 aa     Download sequence    Send to blast
MDMNGNEVVM THEEHVGVRM SNNLDLNLEQ ECRSPKSSNM NGAHQSSRSS ENEVLKIGTE  60
FESDEQAYRF YNKYAELVGF SIRKDWVNRS KVHGRVMSRK FTCSRQGHRK KDKRDVNVKK  120
HRKETRTGCM AHMVVTRQAD RKYIVTQFEE GHNHEDVNLT KAEKLLESPL SGKRDSTEVS  180
ETDSIKNSEI QSKLSFQLLG IRFCPPENFD DLEINDEIFL SSSRTRDMKE GDAASLMYYF  240
HRQHFLNPSF FYSVQLDADD KVSNIFWADD NMIMEYGHFG DVICLDTSCT RNPNSRPFVQ  300
FIGLNNHRQV VLFGAAFLYD DTVNSFKWLF RTFVEAMAGK KPKFILSDQD ATVVQAIHAV  360
LPETNHYICA WQMYLIALKH LRHVVKEFDS FAVDFRSCIF GHEQEEDFIN AWDSMLESHG  420
LRHNAWLRWM FREKEKWAVA YGRNTFFIER DGTHLVELFS DKLRSYLDPD TEMLQFFKHF  480
ESVVNEQRYK ELESTFNMGR HVPVLMANAV FLKYPSETYT PKAFEVFQRE YEKCLNVVIN  540
KCGERDTRSD YKAKTYGKSR DFSVMYNSLD GTVSCNCMKF EHAGFLCSHA LKVLDHQNIK  600
VVPSYYVLKR WTKDARILPV GESHCSTEND NKKVLATRYK DLCRSIIKIS ARAAESDTAF  660
DFATRKLDEV MQGIERILNF KSFEEDKAFC ASDNELPDVD LGRNEFDDQD IEVLKGTAET  720
ECIIPDKDQL NHCDPSPPET VLSVACPPSA YISSPSPPPS MSPLTQGLYT IDANHMVQSI  780
YQGPNLIINQ QPNSNMYEPQ NFYSSQNHSP SHAQFMQESL IRNQFQDPMS NGTQLKPVMD  840
DDQHPHSSSF MHYNHRYRAA GV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.F01137.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012858488.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
TrEMBLA0A022PT460.0A0A022PT46_ERYGU; Uncharacterized protein
STRINGMigut.F01137.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-95FAR1-related sequence 5