PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.F00995.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family GRF
Protein Properties Length: 446aa    MW: 48569.5 Da    PI: 8.998
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.F00995.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC741.7e-23201244245
               WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        epgrC+RtDGKkWRCsr+v + +k+C+rHlhrgr rsrk++e+
  Migut.F00995.1.p 201 LEPGRCKRTDGKKWRCSRDVAPTQKYCDRHLHRGRPRSRKPVET 244
                       69***************************************996 PP

2QLQ45.32.7e-16147179234
               QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                       +FT  Q+ +L++Q+++yKy+++++PvP +Ll++
  Migut.F00995.1.p 147 PFTSVQWKELERQAMIYKYMISSVPVPLDLLFP 179
                       8**************************999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.9E-6146182IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.961147182IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-11147179IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.166200244IPR014977WRC domain
PfamPF088792.2E-19202243IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
LPLKSAIKEE NFFTSIFVLF LILFSNFGYG SVNILSPVSS KSWFFYSRIF YLKKNSNMEK  60
GCNTSCCSIS SSGFSVSDKK SSPNSLFVTN STKICMSAGT HGGGAGENIA RSKNPFGAYT  120
PFAHSTIPSY NKYPAGGGSS MEEGYHPFTS VQWKELERQA MIYKYMISSV PVPLDLLFPP  180
PIIVNSSPPP PPSSYSKTGD LEPGRCKRTD GKKWRCSRDV APTQKYCDRH LHRGRPRSRK  240
PVETTSTTTT LPHKHNNNNI ILNPHKKIRT THHQIVSANP NANEPLLFFN PPKSDLTNRG  300
LVLNDVVAEG KEGFSDYRPI FHEDYSRAFC NQNFSPPEIE VPNNGFIDAW SSIDDYNLNS  360
SSNGGGGGDL SSPTSLNLSI GSRVKESVWF AGGGPLGEAL SSPAATTVSS PSGVLQRTMF  420
SHSDGGSVCN SPTAFAADAP LYWLN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.F00995.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012858203.10.0PREDICTED: growth-regulating factor 2-like
TrEMBLA0A022PV701e-176A0A022PV70_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.14e-29growth-regulating factor 7