PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.F00160.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family GRF
Protein Properties Length: 461aa    MW: 50617.3 Da    PI: 7.7408
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.F00160.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.92e-24168210244
               WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                        epgrC+RtDGKkWRCsr+v +g+k+CErHlhrgr rsrk++e
  Migut.F00160.1.p 168 LEPGRCKRTDGKKWRCSREVAPGHKYCERHLHRGRPRSRKPVE 210
                       69**************************************986 PP

2QLQ54.34.1e-19111145236
               QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                       +FT aQ+ +L++Q+++yKy+++++PvPp+Ll++++
  Migut.F00160.1.p 111 PFTCAQWKELERQAMIYKYMISSVPVPPNLLFPLS 145
                       8*******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.1E-12110146IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.953111146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-13111144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.934167211IPR014977WRC domain
PfamPF088791.6E-20169210IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MEKGATVRTN GFNISDNKLL LSSNSDEIVR LMKQKLHHPH PHPHPHHHSS DEEVFPSKIW  60
MDLHRHRPVD AGGANEAAAV GRDDPSSSYS TTTTAPPYKS LGGGGMAAAF PFTCAQWKEL  120
ERQAMIYKYM ISSVPVPPNL LFPLSRTDNY SPSSLVYNGG GYSKNGDLEP GRCKRTDGKK  180
WRCSREVAPG HKYCERHLHR GRPRSRKPVE LAKNDAVLLP NKKTRLQHQH LPISTPTTSL  240
HLAAASATTT TTTLPKSDPT ISSYKGFNRD MGFGFANEGS SIYGSTPIFH QDYYMDQLQL  300
NMLPYNPTME IGPQATGFID AWSTDNLNTN NQNNNGSNEY SLSWMNRGDF SPSLDLSIAM  360
AAGNFIDSEM GNVRMGADHE ENTIKDSDSS MPSPVFWEPF GRGGPLAEAL QVTSPRECSI  420
GTPATTVSSP SGVVYNNNNN SNSRTDHGSV CNSPTFHRFS *
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.F00160.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843420.10.0PREDICTED: growth-regulating factor 7-like
TrEMBLA0A2G9HZL01e-110A0A2G9HZL0_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-37growth-regulating factor 7