PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E01434.1.p
Common NameLOC105967211, MIMGU_mgv1a009654mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family CO-like
Protein Properties Length: 336aa    MW: 36588.9 Da    PI: 5.0264
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E01434.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.36.3e-081147437
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...H 37
                      + C++++   ++ fC+ ++ +lC+ C    H     H
  Migut.E01434.1.p 11 KPCDTCKAAAATVFCRADSAFLCAACDADAHAAdsrH 47
                      67******99******************999555556 PP

2zf-B_box27.85.2e-095095342
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                       ++C+ +e+ ++   C+ +   lC++C   +H+       H+++p+
  Migut.E01434.1.p 50 VWVCEVCEQAPAAVTCKADAAALCPTCDRDIHSAnplalrHERIPI 95
                      689*****************************66999999999886 PP

3CCT71.42.2e-24280323144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+++RYkeKrk+RkFeK+irY+sRKa+Ae+RpRvKGrF+k++
  Migut.E01434.1.p 280 REARVMRYKEKRKNRKFEKTIRYASRKAYAETRPRVKGRFAKRE 323
                       9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.064845IPR000315B-box-type zinc finger
PROSITE profilePS5011910.665852IPR000315B-box-type zinc finger
PfamPF006438.3E-61147IPR000315B-box-type zinc finger
PROSITE profilePS5011910.5094895IPR000315B-box-type zinc finger
SMARTSM003369.5E-144895IPR000315B-box-type zinc finger
PfamPF006434.0E-75095IPR000315B-box-type zinc finger
CDDcd000216.16E-85195No hitNo description
PROSITE profilePS5101716.807280322IPR010402CCT domain
PfamPF062038.9E-19280322IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGGQSWSLTA KPCDTCKAAA ATVFCRADSA FLCAACDADA HAADSRHARV WVCEVCEQAP  60
AAVTCKADAA ALCPTCDRDI HSANPLALRH ERIPIVPFYD AADVSVKKSS TRAAAAAGEC  120
SDEEAEAASW LLPDPNSKPD DESGLPEYKS AGYLFNEMDP YLDLDLGSGQ QKLMISRAMV  180
NDDDQQKQYC SDGVVPVQKE NEYGSGRYPG PAVDGFPTYD LDYPAAAAKP FMYNFTSQSI  240
TQTVSCSSMD VGVVPDDSTT VDISNTQKEE LPVRLSGVDR EARVMRYKEK RKNRKFEKTI  300
RYASRKAYAE TRPRVKGRFA KRETDASSYG VVPTY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.E01434.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847260.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X1
RefseqXP_012847261.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X2
SwissprotQ940T91e-84COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A022QPG50.0A0A022QPG5_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.15e-71CONSTANS-like 5