PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.D02326.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family FAR1
Protein Properties Length: 723aa    MW: 82423.4 Da    PI: 6.016
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.D02326.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1301.8e-0984116234
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfv 34 
                       fYn+YA++vGFs+r+s+s++s+++g i++r fv
  Migut.D02326.1.p  84 FYNSYARRVGFSTRVSSSRRSRKDGAIIQRSFV 116
                       9******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.6E-784116IPR004330FAR1 DNA binding domain
PfamPF105511.6E-29257349IPR018289MULE transposase domain
PROSITE profilePS5096610.608507550IPR007527Zinc finger, SWIM-type
PfamPF044341.0E-9524548IPR007527Zinc finger, SWIM-type
SMARTSM005759.1E-10525552IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MENGVIEFDI GLSGGDDGID IETPNDDGEE MGGASPNDAN SIGSGSGGDA TSSFSLHTYL  60
PDGDIDLEPY EGMEFESEES AKAFYNSYAR RVGFSTRVSS SRRSRKDGAI IQRSFVYSGK  120
WVVSGFVREH NHELVPPDQV HCLRSHRQIS GPAKTLIDTL QAAGMGPRRI MSVLVKEYGG  180
ISKVGFTEVD CRNYMRNNRQ RNMEGDIQLL LDYLKQKQSE NPSFFYAIQG DEDQYTGNVF  240
WADPKSRSDY NHFGDTVTFD TTYRSNRYRL PFVPFTGLNH HGQPVLFGCA FLINESEASF  300
VWLFKTWLSA MFGRSPLSIT TEHDSVIRSA IMQVLPNTRH RFCKWHMFKQ CQEKLSHVLL  360
QHPQFEAAFQ KCVNLSESAE EFESSWHLLL DKYELVDHSW LQSIYADRRQ WVPVYLRDTF  420
FAEMSVTYMN SYFDGYVNAS TNLNQFFKLY EKALESRHEK EVKADFDTMN TSPVLKTPSP  480
MEKQASEFYT RKLFTRFQEE LVSTLTFTAS KVDDNGEVTT YRMRASCSCR MFEFSGLLCR  540
HVLAVFRVTN VLTLPSYYIS KRWTRNAKSS VVLEERAVDP FNGYLESHTV RYNTLRHEAF  600
KFVDEGAESV ESYNVAMAVL MEASNKVACV VKNEGKASVN NGPMRNKSSY CRSEGEGSST  660
QQLSEADMDQ KINELSMDLE SANRKCEVYR TNLLSLLKDI EDHKQRLSIE VQNIKLSMKD  720
GL*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.D02326.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012837945.10.0PREDICTED: LOW QUALITY PROTEIN: protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2G9G6P20.0A0A2G9G6P2_9LAMI; Uncharacterized protein
STRINGMigut.D02326.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]