PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.D00437.1.p
Common NameLOC105957677, MIMGU_mgv1a020209mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NAC
Protein Properties Length: 269aa    MW: 30994.4 Da    PI: 5.9038
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.D00437.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.42.8e-49101381129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF P+deelv++yL kkv ++++    ++ e+d++ +ePw+Lp  +k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++v+
  Migut.D00437.1.p  10 LPPGFRFYPSDEELVCHYLYKKVCNEQILR-GTLVEIDLHVCEPWQLPDVAKLNSNEWYFFSFRDRKYATGFRANRATISGYWKATGKDRAVV 101
                       79*************************877.78***************87778899************************************* PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +  ++++vg++ktLvfy +rap+g kt W+mhe+rle
  Migut.D00437.1.p 102 DPkTRAVVGMRKTLVFYMNRAPNGIKTGWIMHEFRLE 138
                       9856778***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-609156IPR003441NAC domain
PROSITE profilePS5100556.75810156IPR003441NAC domain
PfamPF023654.3E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGLRDIGETL PPGFRFYPSD EELVCHYLYK KVCNEQILRG TLVEIDLHVC EPWQLPDVAK  60
LNSNEWYFFS FRDRKYATGF RANRATISGY WKATGKDRAV VDPKTRAVVG MRKTLVFYMN  120
RAPNGIKTGW IMHEFRLENP HVPPKEDWVL CRVFHKSRSG ENSSNLVDSP TYNNNNNIEQ  180
QIIMPNYGHQ NDTVSFYHTT PYHHLHQHGQ NPSTSIDPAV YVHVDNGDKM VDDDEAANNN  240
TYKCDVDNDY GFLFDFDDPD NNGDMGFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-48916216171NO APICAL MERISTEM PROTEIN
1ut4_B2e-48916216171NO APICAL MERISTEM PROTEIN
1ut7_A2e-48916216171NO APICAL MERISTEM PROTEIN
1ut7_B2e-48916216171NO APICAL MERISTEM PROTEIN
3swm_A3e-48916219174NAC domain-containing protein 19
3swm_B3e-48916219174NAC domain-containing protein 19
3swm_C3e-48916219174NAC domain-containing protein 19
3swm_D3e-48916219174NAC domain-containing protein 19
3swp_A3e-48916219174NAC domain-containing protein 19
3swp_B3e-48916219174NAC domain-containing protein 19
3swp_C3e-48916219174NAC domain-containing protein 19
3swp_D3e-48916219174NAC domain-containing protein 19
4dul_A2e-48916216171NAC domain-containing protein 19
4dul_B2e-48916216171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
UniProtTranscription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}.
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.D00437.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17251269, ECO:0000269|PubMed:17287247}.
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012837084.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotO040172e-58NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
SwissprotQ84TE67e-59NAC22_ARATH; NAC domain-containing protein 21/22
SwissprotQ9S8511e-58NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A022S2920.0A0A022S292_ERYGU; Uncharacterized protein
STRINGMigut.D00437.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.14e-91NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M
    The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development.
    Front Plant Sci, 2014. 5: p. 165
    [PMID:24817871]
  5. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  6. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  7. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  8. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  9. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  10. Vialette-Guiraud AC, et al.
    A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids.
    Front Plant Sci, 2015. 6: p. 1239
    [PMID:26793217]
  11. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  12. Cui X, et al.
    REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis.
    Nat. Genet., 2016. 48(6): p. 694-9
    [PMID:27111035]
  13. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]
  14. Biot E, et al.
    Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis.
    Development, 2016. 143(18): p. 3417-28
    [PMID:27387872]
  15. Zheng M, et al.
    Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development.
    Plant Physiol., 2016. 172(2): p. 1117-1130
    [PMID:27535792]
  16. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  17. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  18. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  19. González-Carranza ZH, et al.
    HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression.
    PLoS ONE, 2017. 12(9): p. e0185106
    [PMID:28934292]
  20. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]
  21. Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL
    Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves.
    New Phytol., 2018. 217(3): p. 1307-1321
    [PMID:29139551]
  22. Gonçalves B, et al.
    GDP-L-fucose is required for boundary definition in plants.
    J. Exp. Bot., 2017. 68(21-22): p. 5801-5811
    [PMID:29186469]
  23. Sha S, et al.
    To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes.
    Ann. Bot., 2018. 121(2): p. 255-266
    [PMID:29267935]
  24. Maugarny-Calès A, et al.
    Dissecting the pathways coordinating patterning and growth by plant boundary domains.
    PLoS Genet., 2019. 15(1): p. e1007913
    [PMID:30677017]