PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.B01886.1.p
Common NameMIMGU_mgv1a0027261mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family ARF
Protein Properties Length: 645aa    MW: 72485.8 Da    PI: 6.9785
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.B01886.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.92.3e-24101202198
                       EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                       f+k+lt sd++++g +++ +k+a+e+     +++++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF +d+ +
  Migut.B01886.1.p 101 FCKILTASDTSTHGGFSVLRKHANEClppldMSQQTPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFLRDD-D 192
                       99*****************************555556679************************************************655.8 PP

                       EE..EEEEE- CS
                B3  89 efelvvkvfr 98 
                       ++el+v+v+r
  Migut.B01886.1.p 193 NGELRVGVRR 202
                       9999****98 PP

2Auxin_resp100.12.9e-33228307183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+++k+svG Rfkm+fe+eds+err++Gt+vgv +l++ +W++S WrsL+
  Migut.B01886.1.p 228 ASHAITTQTRFVVYYKPRT--SQFIIGLNKYLEAMQQKFSVGKRFKMRFEGEDSPERRFTGTIVGVGELSS-QWTGSTWRSLQ 307
                       789***************6..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.84E-4189231IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-4093217IPR015300DNA-binding pseudobarrel domain
CDDcd100173.51E-2299202No hitNo description
PfamPF023621.8E-22101202IPR003340B3 DNA binding domain
SMARTSM010195.9E-22101204IPR003340B3 DNA binding domain
PROSITE profilePS5086312.294101204IPR003340B3 DNA binding domain
PfamPF065074.1E-31228307IPR010525Auxin response factor
PfamPF023096.2E-7506564IPR033389AUX/IAA domain
SuperFamilySSF542774.76E-14523605No hitNo description
PROSITE profilePS5174526.511529621IPR000270PB1 domain
PfamPF023096.0E-7575618IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MEGVCRTFSG CPCNRERVYY FPQGHMEQLE ASTNQELDQQ IPLFNLPSKI LCRIVDIQLR  60
AEQETDEVYA QITLHPEPDQ TEPTSLDPSP PDPPKPNVRS FCKILTASDT STHGGFSVLR  120
KHANECLPPL DMSQQTPTQD LVAKDLHGYE WRFKHIFRGQ PRRHLLTTGW STFVTSKRLV  180
AGDSFVFLRD DDNGELRVGV RRLARQQSTM PPSVISSQSM HLGVLATASH AITTQTRFVV  240
YYKPRTSQFI IGLNKYLEAM QQKFSVGKRF KMRFEGEDSP ERRFTGTIVG VGELSSQWTG  300
STWRSLQVQW DEESANIFRP ERVSPWEIEP FAEDASQSAM KIKRPRPLDL PRTGTTTTTA  360
SAASPLWYSK STASVERAHL TNDVQNNENG QIFWHAKQKD LSSGLYYSTS YPGGFLPPLS  420
HVENKNVLVK SPLSTRASSF LEQGQGVKNS ETAPAPACRL FGFDLRNKNS DKITSSEKVV  480
PLLSEEADMA KNVEILNSSN NKERKQLNVP LEYSPNDMKG KLGFGSSSRT RIKVQMQGIA  540
VGRGVDLAAF GGYNELINEL EDMFGIKGEL SPRNKWEVVY TDNEGDMMLV GDDPWPEFCK  600
MARKICIYSS EEVKKMSPKC KLHTPSLDDE GTNFSLESEQ KPET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1611233135355Auxin response factor 1
4ldw_A1e-1611233135355Auxin response factor 1
4ldw_B1e-1611233135355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1342346KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.B01886.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843869.10.0PREDICTED: auxin response factor 11
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLA0A022QU950.0A0A022QU95_ERYGU; Auxin response factor (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]