PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.A00750.1.p
Common NameLOC105973775, MIMGU_mgv1a002357mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family TALE
Protein Properties Length: 685aa    MW: 75529.2 Da    PI: 6.9086
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.A00750.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.7e-094414781954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Migut.A00750.1.p 441 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 478
                       554459******************************88 PP

2BELL1116.9e-36305373472
              BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       elq++kakLl++leeVd+rYk+y++q+++vissFe  ag gsa++Y slA++a+SrhFrcL+d i++qi
  Migut.A00750.1.p 305 ELQRRKAKLLQMLEEVDRRYKRYCDQMKAVISSFESTAGNGSARVYSSLASRAMSRHFRCLRDGIVSQI 373
                       89******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.1E-45248371IPR006563POX domain
PfamPF075265.4E-40253369IPR006563POX domain
PROSITE profilePS5007112.179419482IPR001356Homeobox domain
SMARTSM003895.8E-9422486IPR001356Homeobox domain
CDDcd000862.56E-11422483No hitNo description
SuperFamilySSF466896.42E-17423488IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27425488IPR009057Homeodomain-like
PfamPF059209.3E-18439478IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MAGREEKSRD IMVAQSGYNI YSDVSSSTGN QNIPAAQFMS HPPTQQSFDP STTSTSAAEI  60
YNLTAGMEMI GFPSKHHHHH HHHHQHTTEN PGFWKGFFSS ATKPTGNINN NNGGGASSSS  120
SKEITDDPTS ADHFYQHQQN YSDAIQNQTP PSSSSWNNIH HHQNRFLGDD GGGGAVFPCE  180
GNERPSQGLS LSLSSSNPST IQLQSFQLIR HQQQNQNQNQ NQHVINMQSD VLMHHHHHQH  240
VIDNIHNHQS HAVITNSKYL LPTQELLYEF CSLQTDEIDH KSKPPKPTDS SLVDETAIKT  300
LDLLELQRRK AKLLQMLEEV DRRYKRYCDQ MKAVISSFES TAGNGSARVY SSLASRAMSR  360
HFRCLRDGIV SQIKAAKKAM GDKDVSAPGS VKGETPRLRL LDQTLRQQRA MQQMSLMESH  420
PWRPQRGLPE RSVSVLRAWL FEHFLHPYPS DVDKHILARQ TGLSRSQVSN WFINARVRLW  480
KPMVEEMYLE ELKEDEGVAG DGSGGGGGAA VYENDGLMSS QNHSRSEDLK PSHDQLVRMD  540
SECLSSIINN NNEAKRNKGG AAAAVQNEQH HQINPSFGRV IGDSYGSAAM ELDFSSYSHH  600
SSGGGSTVHY GGGGGGGVSL TLGLHQHGGG GVGLGTTQNS LFYGGRSEQM VEDNNQYTLL  660
DGGENQNLPY RNLMGAQLLH DLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B6e-16428485158Homeobox protein Meis1
4xrs_A6e-16428485158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012854274.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_012854275.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_012854276.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-121BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A022Q8E40.0A0A022Q8E4_ERYGU; Uncharacterized protein
STRINGVIT_02s0025g00200.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.14e-85TALE family protein