PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.A00611.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family ARF
Protein Properties Length: 676aa    MW: 75601.8 Da    PI: 6.2147
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.A00611.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.81.2e-24133234199
                       EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                       f+kvlt sd++++g +++ +k+a+e+     +++++ +++l+ +d++g +W +k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +
  Migut.A00611.1.p 133 FCKVLTASDTSTHGGFSVLRKHANEClppldMNQQTPTQELIAKDLHGTEWHFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RGE 223
                       99****************************9555555679************************************************..449 PP

                       EE..EEEEE-S CS
                B3  89 efelvvkvfrk 99 
                       ++el+v+v+r+
  Migut.A00611.1.p 224 TGELRVGVRRH 234
                       999******97 PP

2Auxin_resp85.41.2e-28259337182
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                       a+ha+ t++ F v+Y+Pr+  s+F++ ++k+++al++ + vG +fk +fe++ds+err+sGtv+gv+d++p +W++SkWr  
  Migut.A00611.1.p 259 ASHAVLTQTLFVVYYKPRT--SQFIIGLNKYLEALDHDFGVGVKFKKRFEGDDSPERRFSGTVIGVEDISP-HWEDSKWRTF 337
                       68999*************6..9***********************************************99.********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.6E-43123248IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.66E-41124262IPR015300DNA-binding pseudobarrel domain
CDDcd100172.23E-21131233No hitNo description
PROSITE profilePS5086312.351133235IPR003340B3 DNA binding domain
SMARTSM010193.7E-22133235IPR003340B3 DNA binding domain
PfamPF023621.4E-22133234IPR003340B3 DNA binding domain
PfamPF065073.5E-26259337IPR010525Auxin response factor
PfamPF023095.7E-7553600IPR033389AUX/IAA domain
SuperFamilySSF542772.06E-12562640No hitNo description
PROSITE profilePS5174526.538564645IPR000270PB1 domain
PfamPF023094.8E-6610648IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MANRSSFSQQ HHQPNSVSTE GSWGKDSLYE ELWKACAGPL VDVPKVGERV YYFPQGHMEQ  60
LEASTNQELN QRIPMFNLPS KILCRVFDIK LQAEQDTDEV YAQITLMPEA DQTEPRSPDS  120
SPDEPPRPSV HSFCKVLTAS DTSTHGGFSV LRKHANECLP PLDMNQQTPT QELIAKDLHG  180
TEWHFKHIFR GQPRRHLLTT GWSTFVTSKR LVAGDSFVFL RGETGELRVG VRRHARQQSS  240
MPSSVISSQS MHLGVLATAS HAVLTQTLFV VYYKPRTSQF IIGLNKYLEA LDHDFGVGVK  300
FKKRFEGDDS PERRFSGTVI GVEDISPHWE DSKWRTFKVQ WDEPASIQRP ERVSPWEIEP  360
FVASNPTNTI QPLTMKHKRP RPLVEIPVPE TMTTSPLSPA WNLTQDSHKI NRVSDGLRSN  420
HSTNSLNKQT DAPSDGGQQF SLQINASPNM AAAEETDESK SASAWSVITN ISAPSSGKQG  480
NSHNNEGTKS DTIASCRLFG FDLKRPSVVT LCDNNSPFKS VDVSNDLLCS GDSDQKSGVS  540
KELKQDQLQT LSKEVQNRQI NSSRSRTKVQ MQGVAVGRAV DLTTLNGYND LINELEEMFE  600
IKGELRPRNK WEIVFTDDEG DMMLVGDDPW PEFCNMVRRI LICSSQDTKK MKASKLPLPT  660
AECEATGLNL ECIED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1782636117355Auxin response factor 1
4ldw_A1e-1782636117355Auxin response factor 1
4ldw_B1e-1782636117355Auxin response factor 1
4ldx_A1e-1782636117355Auxin response factor 1
4ldx_B1e-1782636117355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1377381KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.A00611.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4804972e-33AM480497.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X102651.45, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012854189.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A022Q6Q90.0A0A022Q6Q9_ERYGU; Auxin response factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9