PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.A00403.1.p
Common NameLOC105975347, MIMGU_mgv1a008870mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family CO-like
Protein Properties Length: 361aa    MW: 39572 Da    PI: 5.2997
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.A00403.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.79.7e-081142435
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHk 35
                      ++C+ ++  ++  fC+ ++ +lC +C  ++H 
  Migut.A00403.1.p 11 KVCDSCKASPAAVFCRADSAFLCMTCDAKIHA 42
                      79*****************************5 PP

2zf-B_box27.18.5e-095397341
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                       ++C+ +e+ +++  C+ +   lC+ C   +H+       H++ p
  Migut.A00403.1.p 53 LWVCEVCEQAPATVTCKADAASLCAACDRDIHSAnplarrHERLP 97
                      689*****************************6578888888765 PP

3CCT69.68e-24288332145
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                       Rea++lRY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k++e
  Migut.A00403.1.p 288 REARVLRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRSE 332
                       9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.0E-11855IPR000315B-box-type zinc finger
PROSITE profilePS5011910.58855IPR000315B-box-type zinc finger
PfamPF006434.8E-61142IPR000315B-box-type zinc finger
CDDcd000217.23E-81255No hitNo description
PROSITE profilePS5011910.2815198IPR000315B-box-type zinc finger
PfamPF006438.9E-75397IPR000315B-box-type zinc finger
CDDcd000213.47E-85497No hitNo description
SMARTSM003365.4E-95698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.857288330IPR010402CCT domain
PfamPF062031.0E-17288330IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGAETWSLTA KVCDSCKASP AAVFCRADSA FLCMTCDAKI HAANKLASRH ARLWVCEVCE  60
QAPATVTCKA DAASLCAACD RDIHSANPLA RRHERLPAVP FYDSASAAKS SPSPSDATAA  120
AEQECSEEEA EAASWLLPNK FEEESGSPEY KSADYLFTDM DPYNLDLDLI SGEQKPQLII  180
TNDEQQQHKH YSSDGVVPVQ TKTEFGSTHY PGPVVDGFPT YEMDYPGAPK PFMYNFTSQS  240
ISQSVSSSSM EVGVVPEDHN AAMADISDST TFACKNEPPP VPVSGVDREA RVLRYREKRK  300
NRRFEKTIRY ASRKAYAETR PRVKGRFAKR SEMIEVDSLN IDASSANRHD SSSYSVVPSF  360
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMigut.A00403.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012855991.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T97e-93COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A022Q2740.0A0A022Q274_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-87CONSTANS-like 4