PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.S031200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HD-ZIP
Protein Properties Length: 309aa    MW: 34955.4 Da    PI: 6.6788
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.S031200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.71.9e-1891143456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        + +++ eq+++Le+ Fe+ +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Manes.S031200.1.p  91 KKRLNLEQVKALEKSFEMRNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWK 143
                        4568889*********************************************9 PP

2HD-ZIP_I/II126.99e-4189181193
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekk+rl+ eqvk+LE+sFe+++kLeperK++la++Lglqprqva+WFqnrRAR+ktkqlEkdye Lk+++d +k++n++L++ +++L++el+
  Manes.S031200.1.p  89 EKKKRLNLEQVKALEKSFEMRNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWKTKQLEKDYEILKKQFDVVKADNDALQALNKRLHAELM 180
                        69**************************************************************************************9997 PP

        HD-ZIP_I/II  93 e 93 
                        +
  Manes.S031200.1.p 181 A 181
                        5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-2061146IPR009057Homeodomain-like
SuperFamilySSF466891.71E-1981147IPR009057Homeodomain-like
PROSITE profilePS5007117.23285145IPR001356Homeobox domain
SMARTSM003894.5E-1788149IPR001356Homeobox domain
CDDcd000869.49E-1690146No hitNo description
PfamPF000461.2E-1591143IPR001356Homeobox domain
PRINTSPR000319.0E-6116125IPR000047Helix-turn-helix motif
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
PRINTSPR000319.0E-6125141IPR000047Helix-turn-helix motif
PfamPF021833.1E-13145184IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MVDRSLTRLI DMAFPLHHHG FIFHSQEDND HLLSPSSLNS LPSSCPPQLF PGGGGHFMMK  60
RSMSFSGVEK CEEVHGDDDL SDDGSQIGEK KKRLNLEQVK ALEKSFEMRN KLEPERKMQL  120
AKALGLQPRQ VAIWFQNRRA RWKTKQLEKD YEILKKQFDV VKADNDALQA LNKRLHAELM  180
ALRSSTESNS TEVNPKKETD QGSWSNASEN GHDANLDISI TTVATSPVSN SQLSTKLLFS  240
TSIRPTSMTQ LLQSSSPRPD LQCLKVDQLV QEENICNMFN GMEEQQGFWP WPEQQAPFSL  300
NQTHFSKN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.S031200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021602356.10.0homeobox-leucine zipper protein HAT7-like
SwissprotQ004666e-86HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A199UBF40.0A0A199UBF4_MANES; Uncharacterized protein
STRINGcassava4.1_031116m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.17e-80homeobox 3