PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.18G021400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 666aa    MW: 73685 Da    PI: 6.0158
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.18G021400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.56.3e-104154521954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +e+  LAk++gLt +qV +WF N R +
  Manes.18G021400.1.p 415 FEHflHPYPNDSEKITLAKQTGLTRNQVANWFINARVR 452
                          664459******************************88 PP

2BELL122.32e-39279350172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erq+ q+kk kLls+l+eVd+rYk y++q+q+v+ssF++vag g+ak+Yt+lA ++iSrhFrcL+dai++qi
  Manes.18G021400.1.p 279 ERQDFQNKKIKLLSMLDEVDRRYKEYYHQMQIVVSSFDMVAGQGAAKSYTALAIQTISRHFRCLRDAISNQI 350
                          799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.7E-57200348IPR006563POX domain
PfamPF075267.1E-48207347IPR006563POX domain
PROSITE profilePS5007112.617393456IPR001356Homeobox domain
SMARTSM003899.6E-11396460IPR001356Homeobox domain
CDDcd000861.33E-13396457No hitNo description
SuperFamilySSF466893.51E-17397462IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-28399461IPR009057Homeodomain-like
PfamPF059202.2E-17413452IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MSTYYPSLSS QKENLQSLYP GDHKISSYSE LPSHPNNMAM YVNQASAAGA YSEFLTESSL  60
SSDHCAEFAS AGDGNEMMFI PPTSATMSLQ PIDGHLNTAS TDPAGNHVSE QNFQCQGLSL  120
RLGTEMQPAV SVPSFQYQNP SLILPSSSSP HLPVMGKWTL SSGGGENHQC NLIRTEVSRN  180
PQCLDAQKDM HSDAYMYETC GYANATSNSK YLKAAQQLLD EVVNLRKALK QLQSNKCFDD  240
IKENDGKPSS QSILPTSSGI SSGPNESTAN SSSELTSAER QDFQNKKIKL LSMLDEVDRR  300
YKEYYHQMQI VVSSFDMVAG QGAAKSYTAL AIQTISRHFR CLRDAISNQI EITRRRLGEQ  360
SNSPNGQGGI PRLRYVDQQL RQQRALQQFG VMRHAWRPQR GLPESSVSIL RAWLFEHFLH  420
PYPNDSEKIT LAKQTGLTRN QVANWFINAR VRLWKPMVEE IYKEEFADSE ANSKSSLDDA  480
TKALGENQLV SENRLDELQD SLTSAAADSN RTGQVHALKF DPLLDIEMNK PVAKTVLQNN  540
SLGDVTNSRI TKLQGNQRSN MDEQSPYLDK DIPSNQHGDE SLMPAALSYD ISELSGFAIG  600
NQVSLALGLQ HHESDAFPMS GGNQIRGNNI AASSMGPDTI DYHCIYMGKQ QDRLGNSHLL  660
RDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16402460563Homeobox protein Meis2
3k2a_B3e-16402460563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071936.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_012071937.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_012071938.10.0PREDICTED: BEL1-like homeodomain protein 3
TrEMBLA0A067L2430.0A0A067L243_JATCU; Uncharacterized protein
STRINGPOPTR_0002s03240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-112BEL1-like homeodomain 3