PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G112700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 180aa    MW: 19584 Da    PI: 7.8199
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G112700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.21e-41101091100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk lrrkC ++C+++pyfp e+p+kfa+vhk+FGasnv kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l
  Manes.17G112700.1.p  10 PCAACKSLRRKCLPNCIFSPYFPPEEPQKFAIVHKIFGASNVNKLLNEVLPHQREDAVKSLAYEAEARLKDPVYGCVGAISVLQSQVIKL 99 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el+++++ 
  Manes.17G112700.1.p 100 QKELDATQAD 109
                          ****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9559110IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4110107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MASSSYSISP CAACKSLRRK CLPNCIFSPY FPPEEPQKFA IVHKIFGASN VNKLLNEVLP  60
HQREDAVKSL AYEAEARLKD PVYGCVGAIS VLQSQVIKLQ KELDATQADL IRYASSSPSP  120
PSSVLFGRSR MGHGGSSSAS YDQNSVFYYP SPRSNETCGH TQERGDHDKP TEPSNAQDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-60911410115LOB family transfactor Ramosa2.1
5ly0_B6e-60911410115LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.17G112700.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021599051.11e-121LOB domain-containing protein 25-like
RefseqXP_021599052.11e-121LOB domain-containing protein 25-like
SwissprotQ8L8Q39e-61LBD25_ARATH; LOB domain-containing protein 25
SwissprotQ9FML41e-60LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A251IWB91e-129A0A251IWB9_MANES; Uncharacterized protein
STRINGcassava4.1_025381m1e-120(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-62LBD family protein
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  3. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]