PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G051300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 387aa    MW: 42436.6 Da    PI: 8.1158
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G051300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.7e-1858118257
                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  Manes.17G051300.1.p  58 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 118
                          89*****************99*************************************995 PP

2Wus_type_Homeobox112.22.8e-3657119264
    Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                          +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
  Manes.17G051300.1.p  57 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 119
                          689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.0E-750117IPR009057Homeodomain-like
SuperFamilySSF466892.91E-1253123IPR009057Homeodomain-like
PROSITE profilePS5007110.64154119IPR001356Homeobox domain
SMARTSM003896.8E-956123IPR001356Homeobox domain
CDDcd000869.05E-957119No hitNo description
PfamPF000462.0E-1558118IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNSH HHQWQHDITP SSLLSSACHR TPCASGVPGC EERSSEPKPR  60
WNPKPEQIRI LEAIFNSGMV NPPRDEIRKI RAQLQEYGQV GDANVFYWFQ NRKSRSKHKL  120
RHLQNSMQQT HQAPSVTTSI PTLTAPSSSP SSSSEKSSPK ASQGTLSLTT PTVVDIFNSP  180
TGSVNQTYFQ AHNEFVPEPF FFQAHQTGAG GGARPLTQGF CFSDLPNLVQ VQDNTVGPCT  240
SLLLSEIMSS EASKKYLYHE DKNLKIQPRL SYPVTAPISH CIGFAPLPLP TTHPNNVTVP  300
STISQIQGES ASVGSSGAVR STVFINDVAF EVGVGPFNLR EAFGDDFVLI HSSGQPVLTN  360
EWGVTFHSLQ RGASYYLVPI SMNEHI*
Functional Description ? help Back to Top
Source Description
UniProtHomeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.17G051300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021599023.10.0WUSCHEL-related homeobox 9-like isoform X1
SwissprotQ6X7J42e-85WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A2C9U6T20.0A0A2C9U6T2_MANES; Uncharacterized protein
STRINGcassava4.1_023871m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.19e-70WUSCHEL related homeobox 8
Publications ? help Back to Top
  1. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
    J. Exp. Bot., 2014. 65(22): p. 6543-52
    [PMID:25205582]
  3. Raines T, et al.
    The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis.
    Plant J., 2016. 85(1): p. 134-47
    [PMID:26662515]
  4. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  5. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]