PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G030200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GeBP
Protein Properties Length: 180aa    MW: 20426.6 Da    PI: 10.5722
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G030200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57381.41.3e-2566145281
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfs 81 
                          lfqrlwse+Dei++L G+idf++++g++  +d++ f++f+k+s++f+vs +ql +K+ rLKk  +++++k k  k  +f 
  Manes.17G030200.1.p  66 LFQRLWSEDDEILVLEGIIDFTENKGVDHAKDMNSFFDFIKSSLHFDVSLNQLKDKVLRLKKSLRNMKAKGKWVKIRHFL 145
                          79******************************************************************997777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.8E-2067137IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MEENPLKTTK HRSKSLASTQ VAVKSTAAVK RGSETDRDPK ESKRSKKKDS ESDGSVDKPE  60
DIKKQLFQRL WSEDDEILVL EGIIDFTENK GVDHAKDMNS FFDFIKSSLH FDVSLNQLKD  120
KVLRLKKSLR NMKAKGKWVK IRHFLKPIIK NLLICGKRYG AAKQLVGRSD LILKSNGKE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.17G030200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021666793.13e-72probable transcription factor At1g11510
TrEMBLA0A2C9U4F81e-125A0A2C9U4F8_MANES; Uncharacterized protein
STRINGcassava4.1_030371m1e-126(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.16e-18DNA-binding storekeeper protein-related transcriptional regulator