PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G030100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GeBP
Protein Properties Length: 416aa    MW: 46086.2 Da    PI: 5.2748
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G030100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573117.76.4e-37185281298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          lfqrlwse+Dei++L G+idf++k+g++p +d++ f +f+k+s++f+vs sql +K+ rLKkKf+k+v+k k g++++fsk+hdqk+f+l
  Manes.17G030100.1.p 185 LFQRLWSEDDEIAVLEGIIDFTEKKGVDPAKDMNSFLDFIKSSLHFDVSLSQLKDKVWRLKKKFEKHVSKGKMGEDKTFSKAHDQKTFDL 274
                          79**************************************************************************************** PP

               DUF573  92 skkiWgs 98 
                          skkiWgs
  Manes.17G030100.1.p 275 SKKIWGS 281
                          *****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.2E-34186280IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MAPKRSIPLE DPPPASSSSE EESSSGEEEE EEEDGDDGAE AKVEGSSTEE DEANEKQQKP  60
SSQLPQNQTS KPVPEKSHFT TQQAGPESDS DGSETETDSD DDLPNRALGT TVKPIASKLI  120
EENPLKTTKH RSKSLASTQV AVKSTAAVKR GGETDRDPKD SKRSKKKDSE SDGGVEKPDD  180
IKKQLFQRLW SEDDEIAVLE GIIDFTEKKG VDPAKDMNSF LDFIKSSLHF DVSLSQLKDK  240
VWRLKKKFEK HVSKGKMGED KTFSKAHDQK TFDLSKKIWG SEASSGGGVD LVLKSNGKGR  300
KNGNNSQKGK SLTALKAELG ADIEKENEKV DKMEVEMQSH SGKKHILQFD KRVCVAGTED  360
YVVHRGLDML EGPAKKPEME EKWRKLHVAE LELFLKRNEL IREQAKLMLA SYKTE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.17G030100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021598285.10.0probable transcription factor At1g11510
TrEMBLA0A2C9U4G70.0A0A2C9U4G7_MANES; Uncharacterized protein
STRINGcassava4.1_009769m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.14e-30DNA-binding storekeeper protein-related transcriptional regulator