PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G027300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 347aa    MW: 38803.9 Da    PI: 6.5006
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G027300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092773112155
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          k +yps++++  LA+++gL+++q+ +WF N+R ++
  Manes.17G027300.1.p 277 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 311
                          569*****************************885 PP

2ELK38.52.5e-13231252122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK qLlrKYsgyLgsLk+EF+
  Manes.17G027300.1.p 231 ELKGQLLRKYSGYLGSLKKEFM 252
                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.6E-1796140IPR005540KNOX1
PfamPF037902.4E-2098136IPR005540KNOX1
SMARTSM012561.1E-23144195IPR005541KNOX2
PfamPF037911.1E-19147194IPR005541KNOX2
PfamPF037892.2E-10231252IPR005539ELK domain
SMARTSM011886.0E-8231252IPR005539ELK domain
PROSITE profilePS5121311.034231251IPR005539ELK domain
PROSITE profilePS5007112.989251314IPR001356Homeobox domain
SMARTSM003897.4E-13253318IPR001356Homeobox domain
SuperFamilySSF466891.5E-19253328IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-28256316IPR009057Homeodomain-like
CDDcd000861.45E-12263315No hitNo description
PfamPF059206.1E-17271310IPR008422Homeobox KN domain
PROSITE patternPS000270289312IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MECGSNSTSC MMAFGGNSNG LCPTMMMPLM TSHHHPPTPP HPNADSSSNT LLLPLPPTNN  60
QDQNPNSGCC SSMILDDHNH NSNGNTACYF MDNSTASVKV KIMAHPHYHR LLAAYINCQK  120
VGAPPEVVAR LEACASAAVM GPSSTNCIGE DPALDQFMEA YCEMLTKYEQ ELSKPLKEAM  180
LFLQSVDCQF KALTVSSPNS AYGEANERNG SSEEEVDVNS NFIDPLAEDQ ELKGQLLRKY  240
SGYLGSLKKE FMKKRKKGKL PKEARQQLLD WWSRHYKWPY PSESQKLALA ESTGLDQKQI  300
NNWFINQRKR HWKPSEDMQF VVMDAAHSHY YMDNVLSNPF PMDISH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1246255LKKEFMKKRK
2252256KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518420.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-152HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLB9RXF10.0B9RXF1_RICCO; Homeobox protein knotted-1, putative
STRINGVIT_10s0116g00190.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-131KNOX/ELK homeobox transcription factor