PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G004700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family Trihelix
Protein Properties Length: 304aa    MW: 35673.2 Da    PI: 6.0568
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G004700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix82.36.5e-2644125186
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                          +Wt+qe+++Li +r e+e+++  +k+ k+lWe vs+k+rerg++r+p qCk+kw+nl +ryk  ++++ ++      +cp+f++l+
  Manes.17G004700.1.p  44 QWTEQETKDLIGIRAELEKDFTVAKRSKALWEIVSAKLRERGYRRTPDQCKCKWKNLVNRYKGKETSDPEN----GLHCPFFEELH 125
                          7**************************************************************99999974....457******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.1337101IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-439103IPR009057Homeodomain-like
PfamPF138372.3E-2243126No hitNo description
CDDcd122037.54E-2445108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MFSGINNDSL RPMSMAMAST MLSPAEDISP SASKERGQQQ QQQQWTEQET KDLIGIRAEL  60
EKDFTVAKRS KALWEIVSAK LRERGYRRTP DQCKCKWKNL VNRYKGKETS DPENGLHCPF  120
FEELHAVFTE RAKNMQRLLL DSKVGSSQAK KRVKRMSAST SFDELSVGED EDEDGEERLA  180
RSNSQKRKRE RFLTEVSSSV TSTSSPDIGG IQEMLKEFFQ QQQQMEMQWR EMMEKRANDQ  240
QLFELEWRQS MEKMEQERLM IEQAWREREE QRRIREESRA ERRDVLLITL LNKLITENDI  300
EGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1339115177DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070490.11e-150PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLA0A067KU781e-150A0A067KU78_JATCU; Uncharacterized protein
STRINGGLYMA01G35370.21e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.11e-27Trihelix family protein