PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G127500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARR-B
Protein Properties Length: 687aa    MW: 75234.5 Da    PI: 6.0425
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G127500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.6e-28195248155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Manes.16G127500.1.p 195 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 248
                          79*******************.********************************8 PP

2Response_reg78.22.8e-26201281109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl vdD+p+ + ll+++l++ +y +v++++++ +al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+++++++ +
  Manes.16G127500.1.p  20 VLAVDDDPTCLLLLETLLRRCQY-HVTTTSQAIAALKMLRENKnnFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANSDPKLVMK 107
                          799********************.***************888888*******************87754.558***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           +  Ga d+l Kp+ +eel +
  Manes.16G127500.1.p 108 GITHGACDYLLKPVRMEELKN 128
                          ******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.2E-1651683IPR017053Response regulator B-type, plant
SuperFamilySSF521721.27E-3617144IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.0E-4317172No hitNo description
SMARTSM004481.6E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.67519134IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.06E-2421134No hitNo description
PROSITE profilePS5129412.269192251IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-30192253IPR009057Homeodomain-like
SuperFamilySSF466897.17E-20192252IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-25195248IPR006447Myb domain, plants
PfamPF002491.2E-6197247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MTVEQGIGEP RDQFPIGMRV LAVDDDPTCL LLLETLLRRC QYHVTTTSQA IAALKMLREN  60
KNNFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANS DPKLVMKGIT HGACDYLLKP  120
VRMEELKNIW QHVIRRRKFN NKDQNNFANQ DKHHGSGEAG ADQKLNKKRK DQNEEEDEDR  180
DDNEHENEDP TTQKKPRVVW SVELHRKFVA AVNQLGIDKA VPKKILDLMN VEKLTRENVA  240
SHLQKYRLYL KRISTVANQQ ANMVAALGST DSPYLQMGSV NGIGFPNLAG TGQFHAAAFR  300
SLPPSGMLGR LNSPAALGMR SLATTGVIQL GPLQTASHLT NNQSQFQSIV HSGNDGNVLQ  360
GMPMSLEVDQ IPPSNGVTYI RELPTEVNDT TTFSVSNGFP DANIMAGSSN GGFLGVPNKP  420
LMLEGSAQEA QDGQKFGKQS SLAVTAFDSG YSSNFLDQSR CNDSWSSAVQ STGVQSNSFG  480
LNDCFKQATL HPSNIRDSMS TMALQSGNNL SHVSSISTVL THLQDSKADL QCQVASIRSN  540
AGQIIANAPQ GWDDQRQDAP YPSNAVCSSI NSAIPNHGTG NPMGRSLDPN SAIFHRTKSF  600
NSARQSDLVD PFLLKHSEVD NLAMESLMRS DEGYVIGQQK PQGSYFSNNF GSLEDLESVM  660
VKQEQDKVTI TEGELGFGSY SIRKCM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-26191254164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.16G127500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021597224.10.0two-component response regulator ARR12-like isoform X1
TrEMBLA0A2C9UB520.0A0A2C9UB52_MANES; Two-component response regulator
STRINGcassava4.1_002889m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-132response regulator 12