PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G126100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 425aa    MW: 47305.4 Da    PI: 6.2299
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G126100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-073744062254
                          SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           +yp++e++++L +++gL+ +q+ +WF N+R +
  Manes.16G126100.2.p 374 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 406
                          69*****************************87 PP

2ELK27.76.3e-10327348122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELKh+L+++Y++++ ++++E++
  Manes.16G126100.2.p 327 ELKHELKQGYKEKIADIREEIL 348
                          9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.1E-20159203IPR005540KNOX1
PfamPF037901.2E-17161202IPR005540KNOX1
SMARTSM012563.0E-27215270IPR005541KNOX2
PfamPF037911.5E-19220269IPR005541KNOX2
PfamPF037891.9E-5327348IPR005539ELK domain
SMARTSM011880.0012327348IPR005539ELK domain
PROSITE profilePS5121310.109327347IPR005539ELK domain
PROSITE profilePS5007111.758347410IPR001356Homeobox domain
SMARTSM003891.0E-10349414IPR001356Homeobox domain
SuperFamilySSF466895.13E-16349412IPR009057Homeodomain-like
CDDcd000862.92E-11350411No hitNo description
Gene3DG3DSA:1.10.10.608.6E-25354411IPR009057Homeodomain-like
PfamPF059201.2E-17367406IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MAFHHNLSQD LPLHHFSSEQ TQQQQQQNIP ESNAAPNWLN TALLRTQQPQ PPSHSHFTDT  60
NFLNLHTTST TNSDSTASQN PTQWLSRSSS ILNRNHSDVI DDVTAATAAD SIIVGTISHE  120
SPDLKTNTNN NSGTMNNKSE GGVVESGGGG EGVVNWQNAR YKAEILSHPL YDQLLSAHVA  180
CLRIATPVDQ LPRIDAQLAQ SQHVVAKYSA LGGGTQGLAG DEKELDQFMT HYFLLLCSFK  240
EQLQQHVRVH AMEAVMACWE IEQSLQSLTG VSPGEGTGAT MSDDDEDQVD SDANLFDPSL  300
DGSDAMGFGP LIPTESERSL MERVRQELKH ELKQGYKEKI ADIREEILRK RRAGKLPGDT  360
TSVLKSWWQS HSKWPYPTEE DKARLVQETG LQLKQINNWF INQRKRNWHS NPSTSTVLKS  420
KRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12350414872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1403423RKRNWHSNPSTSTVLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012076476.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X3
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A067KBM70.0A0A067KBM7_JATCU; Uncharacterized protein
STRINGGLYMA04G06810.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0KNOTTED1-like homeobox gene 3