PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G097900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YA
Protein Properties Length: 332aa    MW: 36269.1 Da    PI: 9.1405
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G097900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.96.9e-33181237158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          d p+YVNaKQy++Il+RRq+Rakle+++kl  ksrkpylheSRh hAl+R RgsgGrF
  Manes.16G097900.2.p 181 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-VKSRKPYLHESRHLHALNRVRGSGGRF 237
                          57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575122No hitNo description
SMARTSM005214.7E-37179240IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.071180240IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.2E-24183205IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.8E-28183237IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860185205IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.2E-24214237IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MAVRIQNLPK KNFGQANFSF SCPSWWTSNE QQQSLSKNIS FKVESPTQLY HKANHLGLQL  60
LDQESSSIRS IGQSHNEVGT GGEANSQDQC ISSESGQDEG CGKGAEGRMK PVFLFSTPEI  120
ALDPSQTDNS HSMLQARAPF PHADNYVGGL FTPYGRQDIL GSQMVGMTTT RVALPLDLAD  180
DGPIYVNAKQ YHGILRRRQS RAKLEAQNKL VKSRKPYLHE SRHLHALNRV RGSGGRFLST  240
KKLQQSDPTS SSNRHVILDT IQLHQNNETT EHGSFYSRTS QSGNSNTTSS GMTSVSNDES  300
IFRQSDHRFA SLAAHIGGSI QSSGGLMCSG T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20183242463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.16G097900.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021597785.10.0nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_021597786.10.0nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_021597787.10.0nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_021597789.10.0nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A251IZS80.0A0A251IZS8_MANES; Uncharacterized protein
STRINGcassava4.1_011576m0.0(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-42nuclear factor Y, subunit A3