PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G084700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 288aa    MW: 32227.9 Da    PI: 9.4588
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G084700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.23.5e-19781481789
                          E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                   B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                           +p kfa+++++k+ +s +++l+d++ r W  kl ++k++g++++++GW+ F+ an+Lk+gD+++F+l++ ++
  Manes.16G084700.1.p  78 NVPMKFAQANDLKN-RSCKIVLMDQEARAWPAKLGHKKSDGQVYIGQGWSAFCVANHLKAGDSFLFELIK-KG 148
                          58********9885.778****************99*******************************997.44 PP

2B349.38.6e-16178268497
                          E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                   B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                          v+++ +++k+  l +p++fa+ + ++  + ++++l++e+g s  v +  + ksg + +++GW+ F+k+ngL+eg +++++l++  + ++v
  Manes.16G084700.1.p 178 VTVKTYHFKNYHLKIPRNFARMNRLSR-KCFKMILTNEKGSSRVVLV-GKSKSGDVAIGRGWNAFAKENGLREGYVIMLELVK-GGVKPV 264
                          567889999999***********9885.679*********9877777.5666677*************************997.677788 PP

                          EEEE CS
                   B3  94 vkvf 97 
                          +k++
  Manes.16G084700.1.p 265 MKIY 268
                          7775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.4E-2257155IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-2057153IPR015300DNA-binding pseudobarrel domain
CDDcd100172.71E-1959148No hitNo description
PROSITE profilePS5086313.28162158IPR003340B3 DNA binding domain
SMARTSM010195.5E-1364159IPR003340B3 DNA binding domain
PfamPF023624.1E-1876154IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-16169266IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-16171266IPR015300DNA-binding pseudobarrel domain
CDDcd100171.57E-16174268No hitNo description
SMARTSM010192.6E-13175271IPR003340B3 DNA binding domain
PROSITE profilePS5086311.18175271IPR003340B3 DNA binding domain
PfamPF023627.2E-14178268IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
RDMVFDVIVS DPSSCQREYL SFNVKEEIET PEAEEAAKES GPASEDNLEG KAGALLEHPF  60
FVVTVTFYRA RFYNFKQNVP MKFAQANDLK NRSCKIVLMD QEARAWPAKL GHKKSDGQVY  120
IGQGWSAFCV ANHLKAGDSF LFELIKKGRW PILQINEEET DNAAESGCFS STHPCFYVTV  180
KTYHFKNYHL KIPRNFARMN RLSRKCFKMI LTNEKGSSRV VLVGKSKSGD VAIGRGWNAF  240
AKENGLREGY VIMLELVKGG VKPVMKIYVN QGIRNSQGGQ LGKSSGC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.16G084700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021596677.11e-131B3 domain-containing protein REM17-like
TrEMBLA0A2C9UB030.0A0A2C9UB03_MANES; Uncharacterized protein (Fragment)
STRINGcassava4.1_021264m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16161410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.13e-31B3 family protein