PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G079300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 585aa    MW: 64851.7 Da    PI: 6.6532
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G079300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.6e-085005381854
                          HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  Manes.16G079300.1.p 500 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 538
                          5887779******************************88 PP

2BELL86.53.1e-28372441272
                 BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +++l++kk++Llsll+ Vd+rY+q+ ++++tv+s+F+a+++l++ +++t++Al++iS+ +++L+++i++qi
  Manes.16G079300.1.p 372 KRALEAKKTQLLSLLQVVDDRYNQCLDEIHTVVSAFHAATELDP-RIHTRFALQTISFLYKSLRERISNQI 441
                          6899****************************************.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.1E-31289439IPR006563POX domain
PfamPF075261.3E-27294438IPR006563POX domain
PROSITE profilePS5007111.029479542IPR001356Homeobox domain
SMARTSM003896.9E-6482546IPR001356Homeobox domain
CDDcd000863.73E-11482543No hitNo description
SuperFamilySSF466892.78E-15484551IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-26485548IPR009057Homeodomain-like
PfamPF059209.4E-15499538IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MFCANMMENR LFSVPIDVGG RNSTVMEGIG SQITPSSFVQ FDSFDLNNQN QTLDGYSVIP  60
TLRGAPISDL HADNRAAAVV VSEAFTRGTE FQQEFVGGTP ISGPALATLV SSRSGFQETL  120
TNLAISESSM YPLEVLRTYV SDDFSNGLNS SFASSVNYGC NEVFVHMNAK EDINRFPAPV  180
ELAGKAPLRT GFQSYSSMGN LEANNWISTN SVNLSADDPY RSSHFSNELS LSLASSQPSA  240
IHGSHVPDQC SEISCSGVTR HCLKETPCSE QTSSSCKELS LSCGSYRAGQ FSQVISGSRY  300
LHVIQEILAQ IASYSLENLD QMSFSSAGFK IGADIPSGSS YPKEGRMCLM GPDGSPNVDS  360
GFEVRLDPAL QKRALEAKKT QLLSLLQVVD DRYNQCLDEI HTVVSAFHAA TELDPRIHTR  420
FALQTISFLY KSLRERISNQ ILAMGAHFDS GGARETEGSL ETSYLHKQWT LQQLKKKDHQ  480
LWRPQRGLPE RSVSVLRAWM FQNFLHPYPK DAEKHLLAVK SGLTRSQVSN WFINARVRLW  540
KPMIEEMYAE MNRRKARQDE EGTNSNHRNH MISINNLRFN VNQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A4e-15488545158Homeobox protein Meis1
4xrs_B4e-15488545158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015573161.10.0PREDICTED: homeobox protein ATH1
RefseqXP_015573162.10.0PREDICTED: homeobox protein ATH1
RefseqXP_015573163.10.0PREDICTED: homeobox protein ATH1
SwissprotP487311e-119ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A067KP980.0A0A067KP98_JATCU; Uncharacterized protein
STRINGPOPTR_0018s05080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-118homeobox gene 1