PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.16G033500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family VOZ
Protein Properties Length: 482aa    MW: 53098.7 Da    PI: 5.5074
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.16G033500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ428.21.2e-1312084242217
                  VOZ   2 ppsaflgpkcalwdctrpaqg.sewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                          ppsaflgpkcalwdc+rpaqg  + +q+ycssfh +lalneg+pgt pvlrp+gi+lkdgllfaalsak+qgk+vgipecegaatakspw
  Manes.16G033500.1.p 208 PPSAFLGPKCALWDCPRPAQGgLDLCQNYCSSFHHALALNEGPPGTGPVLRPGGIGLKDGLLFAALSAKAQGKDVGIPECEGAATAKSPW 297
                          7******************96389****************************************************************** PP

                  VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldal 180
                          na+elfdls+legetirew+ffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+
  Manes.16G033500.1.p 298 NAPELFDLSVLEGETIREWIFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNTFEWHLYEYEINKCDAC 387
                          ****************************************************************************************** PP

                  VOZ 181 alyrlelklvdekksakgkvskdsladlqkklgrlta 217
                          alyrlelk vd+kk akgk++++s++dlqk+++rlta
  Manes.16G033500.1.p 388 ALYRLELKAVDGKKCAKGKITTESVVDLQKQMVRLTA 424
                          ***********************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MGKGSKINCK SASHKLFKDK AKNRVDDLQG MFMDLQFARK ESRTVDVAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGTL GSFSSDIYRL LQLCEEQDDA TSALAAPKPE PNDQSLQIRD  120
IVVFQEGYGV NQGQQGCNFP FVDQGKNPSS GVHGMMASTI EGAGQLDYHQ YDLSQNLELN  180
FYAGHNSTDL CVEDGVPHIS GYLSSICPPS AFLGPKCALW DCPRPAQGGL DLCQNYCSSF  240
HHALALNEGP PGTGPVLRPG GIGLKDGLLF AALSAKAQGK DVGIPECEGA ATAKSPWNAP  300
ELFDLSVLEG ETIREWIFFD KPRRAFESGN RKQRSLPDYS GRGWHESRKQ VMNEFGGLKR  360
SYYMDPQPLN TFEWHLYEYE INKCDACALY RLELKAVDGK KCAKGKITTE SVVDLQKQMV  420
RLTAEFPTDN KRCVKGRTKV NAKVSVGSVY AAPDGGAPTN ETFDYEPCNY LVENLGDYYV  480
N*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.16G033500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021597291.10.0transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2C9U8K00.0A0A2C9U8K0_MANES; Uncharacterized protein
STRINGcassava4.1_006612m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]