PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.15G190500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family M-type_MADS
Protein Properties Length: 351aa    MW: 40231.4 Da    PI: 9.9449
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.15G190500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.64.3e-101152344
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                         i  +s r  tf kR++ +lKK +   +LC++e+++ii+ ++ 
  Manes.15G190500.1.p 11 IRKESTRMNTFQKRKKSLLKKISKFLILCGVEACLIILVPKE 52
                         67789999*****************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.27E-13186IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-6160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.311153IPR002100Transcription factor, MADS-box
PfamPF003196.2E-111152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGHSRIKMEL IRKESTRMNT FQKRKKSLLK KISKFLILCG VEACLIILVP KEKDERVIKV  60
EATWPSNPDK IKRIINKYKK TDQKKKKVDM EISKLNKQIY EANFPLWDVR LDGFLEDQLR  120
VLIAQLDKKI EVADRKLDRF QENQILMDEF AMRMLYGSQI MENYMNRSNS VRNFSNFHQL  180
FSDVMPLPVN CFLPGQSSYL IPSNSNNSNL QIFSDYQTTS LSRKLMDRNS NSSNLANLQL  240
QLFSDPKPLG VQLQMHSQQI QTSPGTSTSP SFLEDLTMMA KDQYTGNQCG VRTISNVPSF  300
PSLSYLNPSP LMWDNVMFNN ADASFGNVGS ALQTILSRMQ LPMSSMSSYQ *
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.15G190500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021595856.10.0agamous-like MADS-box protein AGL82
TrEMBLA0A2C9UHL40.0A0A2C9UHL4_MANES; Uncharacterized protein
STRINGcassava4.1_033475m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-11M-type_MADS family protein