PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G078300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family Nin-like
Protein Properties Length: 264aa    MW: 30500.8 Da    PI: 5.9005
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G078300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.52.1e-26101150352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          k +s +++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Manes.14G078300.1.p 101 KALSRQTISMYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLMSL 150
                          7899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.90582170IPR003035RWP-RK domain
PfamPF020425.6E-21103150IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MANWQNELAT QESFLAAYPL IESFVPDPFC ASLEIENSTI HGDQDVNGLG DWNEFSTLFD  60
PQKQLLLSCD SARGSSRTEP FEEEKKAKKC REEKVNNSIS KALSRQTISM YFYMPITQAA  120
KELNVGLTLL KKRCRELGIR RWPHRKLMSL QTLIKNVQEM KKVEGEESEK KLREAIEILE  180
RERKMVEETP DMQLENKTKR LRQACFKANY KKRRLMGMID KPSSSSSSTI TNKMMNEDEE  240
NIEEYEEIIS LLADPTSHTN MLF*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.14G078300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021592220.11e-175protein RKD1-like
SwissprotQ9M9U95e-61RKD1_ARATH; Protein RKD1
TrEMBLA0A2C9UJU20.0A0A2C9UJU2_MANES; Uncharacterized protein
STRINGcassava4.1_033219m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.19e-55RWP-RK domain-containing protein