PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G028100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family HD-ZIP
Protein Properties Length: 812aa    MW: 89207.5 Da    PI: 5.9575
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G028100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.9e-21119174156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          ++k +++t++q++eLe +F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  Manes.14G028100.1.p 119 KKKYHRHTPHQIQELEFCFKECPHPDEKQRMELSRRLGLENKQIKFWFQNRRTQMK 174
                          79999************************************************999 PP

2START174.85.2e-553235471206
                          HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela++a++elvk a+ ++p+W ks     + +n++ ++++f++  +     +  ea r++g v+  +  l e+l+d++ +W+e ++    
  Manes.14G028100.1.p 323 ELALAAMDELVKIAQTDSPLWIKSLeggkDALNYEGYTRTFSPCIGvkpssFVAEATRETGTVIISSLALIETLMDVN-RWTEAFPdlia 411
                          5899**************************************99889999999*************************.*********** PP

                          EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
                START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a t++vissg      galq+m ae+q+ sp vp R + f+R+++ql +g+w+ vdvS+d +q+ + s +++ +++lpSg++i++++ng
  Manes.14G028100.1.p 412 RACTIDVISSGmagtknGALQVMHAEFQVVSPFVPvRQVRFIRFCKQLAEGVWAMVDVSIDANQESSFSLPSAACRRLPSGCIIQDMPNG 501
                          *****************************************************************988********************** PP

                          EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           sk+twveh +++++ +h l+rs+++sg+ +ga++w atlqr+ce+
  Manes.14G028100.1.p 502 CSKITWVEHSEYDESAVHHLYRSVLSSGVGFGAQRWIATLQRYCEC 547
                          ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-2294178IPR009057Homeodomain-like
SuperFamilySSF466899.61E-21104176IPR009057Homeodomain-like
PROSITE profilePS5007117.313116176IPR001356Homeobox domain
SMARTSM003893.5E-17118180IPR001356Homeobox domain
CDDcd000869.00E-19119176No hitNo description
PfamPF000461.2E-18119174IPR001356Homeobox domain
PROSITE patternPS000270151174IPR017970Homeobox, conserved site
PROSITE profilePS5084840.187314550IPR002913START domain
SuperFamilySSF559618.79E-31315547No hitNo description
CDDcd088752.37E-111318546No hitNo description
PfamPF018523.8E-47323547IPR002913START domain
SMARTSM002344.3E-34323547IPR002913START domain
SuperFamilySSF559612.93E-19574804No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MSFGDLMITS CSNNVSSDGA GGSKIVADIV TRSNTMYNAG IAHQLPVLSP SIHKSLALSL  60
SLKGKMDSHG DMGLLGEHFD PSIMERIKED GYESRSGSDH LEGASGDDQE TGENKRPRKK  120
KYHRHTPHQI QELEFCFKEC PHPDEKQRME LSRRLGLENK QIKFWFQNRR TQMKTQLERH  180
ENIILRQEND KLRAENELLK QNMTDPICNN CGGLAVLGPV SYEQQQLRIE NSRLKDEIGR  240
VCALANKFLG RPLSSSASPT PPFGSNSMLD LSVGINGYEA LANIETTLPI GLDYNDGITM  300
PFIKQMTSPV VNEIPYDRSM FIELALAAMD ELVKIAQTDS PLWIKSLEGG KDALNYEGYT  360
RTFSPCIGVK PSSFVAEATR ETGTVIISSL ALIETLMDVN RWTEAFPDLI ARACTIDVIS  420
SGMAGTKNGA LQVMHAEFQV VSPFVPVRQV RFIRFCKQLA EGVWAMVDVS IDANQESSFS  480
LPSAACRRLP SGCIIQDMPN GCSKITWVEH SEYDESAVHH LYRSVLSSGV GFGAQRWIAT  540
LQRYCECMAI LASPTISGDD QTVVNISGKK SMVKLAQRMV ENFCSGVCAS SARKWDKLTV  600
ENVGEDVRIL TRKNINDPGE PPGVVLSATT SVWLPITRQR LFDFLRDERL RSEWDILSHG  660
GMMQEMVHIS KGHSRGNCVS LLRASAVSAN ANENNMLILQ ETWNDASSSL IVYAPVDVPS  720
MSVVMNGGDS TYVALLPSGF VIHQGGPSFS NGTLVERDND GGDGGGSLLT VGFQILVNNL  780
PTAKLTVESV ETVNNLISCT IQRINTVLQL T*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.14G028100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021634592.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2C9UK260.0A0A2C9UK26_MANES; Uncharacterized protein
STRINGcassava4.1_032823m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]