PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G014100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family EIL
Protein Properties Length: 590aa    MW: 65431.2 Da    PI: 5.1386
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G014100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3436.81.9e-133384081347
                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          eel+krmwkd+++l+r+ke++k    +++ a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd+
  Manes.14G014100.2.p  38 EELEKRMWKDRVKLRRIKENQKFA--AQQ-AAEKQKPKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDN 124
                          8**************999999963..355.599********************************************************* PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          +raWWkekv+fd+ngpaai+ky+a++l+  +++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+w
  Manes.14G014100.2.p 125 IRAWWKEKVKFDKNGPAAIAKYEAECLAIVEADKN--RNGNSQSVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGDEEW 212
                          ***************************99988888..6899999********************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX..... CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss..... 265
                          w +lgl++ q+ ppykkphdlkk+wkv+vLtavikhmsp+i++ir+++rqsk+lqdkm+akes+++lsvl++ee+++++ s+++      
  Manes.14G014100.2.p 213 WVKLGLPQGQS-PPYKKPHDLKKMWKVGVLTAVIKHMSPDIAKIRRHVRQSKCLQDKMTAKESAIWLSVLSREESLIQQPSSDNGtsgit 301
                          **********9.9**********************************************************************4445677 PP

                          ....XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX.......................XXXXXXXXXXXXXXXXXXXXX..... CS
                 EIN3 266 ....slrkqspkvtlsceqkedvegkkeskikhvqavktta.......................gfpvvrkrkkkpsesakvsskevsrt 328
                                r ++++  +s+++++dv+  ++   + ++++++++                        ++ + krk+++++s+ + ++  s  
  Manes.14G014100.2.p 302 empqGGRGEKKRPAVSSDSDYDVDAVDDGVGSVSSKDNRRNattevealsivqnenpdavqdkePAEKQPKRKRPRGKSSHADQQ--SGP 389
                          7766556689999999999*****5444444666666666667789999999999999999988788888999888888888777..445 PP

                          .XXXXXXX.XXXXXXXXXX CS
                 EIN3 329 cqssqfrgsetelifadkn 347
                            +++   ++ +++++d n
  Manes.14G014100.2.p 390 HLNKHSFAEDARNTVPDIN 408
                          5555544567777777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.6E-12738285No hitNo description
Gene3DG3DSA:1.10.3180.105.9E-72159293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167684.18E-62166288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MGELAEIGAD ISSDIEVDDL RCDNIAEKDV SDEEIEAEEL EKRMWKDRVK LRRIKENQKF  60
AAQQAAEKQK PKQTSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYEAEC LAIVEADKNR NGNSQSVLQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV PPPWWPTGDE EWWVKLGLPQ GQSPPYKKPH DLKKMWKVGV  240
LTAVIKHMSP DIAKIRRHVR QSKCLQDKMT AKESAIWLSV LSREESLIQQ PSSDNGTSGI  300
TEMPQGGRGE KKRPAVSSDS DYDVDAVDDG VGSVSSKDNR RNATTEVEAL SIVQNENPDA  360
VQDKEPAEKQ PKRKRPRGKS SHADQQSGPH LNKHSFAEDA RNTVPDINTA DLAAVECQIN  420
GIEEENDPYT VLRPSEKGLE SGSSLPPSEF NYFPAVPSAN VDPMGSMHVD GSSMFFSVLQ  480
NTELHHGSAY DMYNPSIDFG PTPDARQSQI TMDAPQVRSQ DDGGHASALH RDGNEIIGGE  540
LHQLDKDRPF GSPPPLHSLS LEFGGIPSPY NFEIEEFLLD DELIQCFGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-781652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.14G014100.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0131410.0KR013141.1 Hevea brasiliensis clone HbEIN3-3 ethylene-insensitive3/ethylene-insensitive3-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021592320.10.0ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A251J9D60.0A0A251J9D6_MANES; Uncharacterized protein
STRINGcassava4.1_004424m0.0(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.10.0ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  2. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  3. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  4. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]