PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.14G003100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YA
Protein Properties Length: 355aa    MW: 38052.8 Da    PI: 7.1839
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.14G003100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.51.9e-32176232158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep+YVNaKQyq+Il+RRq+Rak+e ekkl +k+rkpylheSRh+hA+rR+Rg+gGrF
  Manes.14G003100.1.p 176 QEPVYVNAKQYQGILRRRQARAKAELEKKL-IKARKPYLHESRHQHAMRRARGTGGRF 232
                          69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.1E-36174235IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.361175235IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.5E-28177232IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.9E-24178200IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860180200IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.9E-24209232IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MQSKSQSANP LEPDPRVIQP CAVHSEPWWR SIGFNTVSSA VPAGNTSNLS SPDGPNGSLS  60
NDDQSLSNGG VNEDDDDASK ESQATASSQS VSVANCGQGN KSLHHLASSM TTMHDECLTQ  120
PPQLELVGHS IACASNPYQD PYYSGMMAAY GHQPMSYPHL IGLHHARMPL PQEVAQEPVY  180
VNAKQYQGIL RRRQARAKAE LEKKLIKARK PYLHESRHQH AMRRARGTGG RFAKKIHADA  240
SNNTTEGTSN DPGPVLSSQS GSGSSSISEP LPSDSADRWI FPHGEQGTIA SQVLVTSEAK  300
NHVHGGTFYL KHNGLQTLTH HSLAGEKGEE GDCSGQQRGS ISSNQASQRP LSIQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-19176232258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.14G003100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021591865.10.0nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_021591866.10.0nuclear transcription factor Y subunit A-1-like isoform X1
RefseqXP_021591867.10.0nuclear transcription factor Y subunit A-1-like isoform X1
SwissprotQ9LXV52e-77NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A251JPR90.0A0A251JPR9_MANES; Uncharacterized protein
STRINGcassava4.1_007505m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40123461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.32e-59nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Siriwardana CL, et al.
    NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T.
    PLoS Genet., 2016. 12(12): p. e1006496
    [PMID:27977687]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]