PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G134500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 820aa    MW: 88412.2 Da    PI: 7.2261
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G134500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-095796161954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Manes.13G134500.1.p 579 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 616
                          664459******************************88 PP

2BELL123.11.1e-39439510172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdaia q+
  Manes.13G134500.1.p 439 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAIAAQL 510
                          589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-82361508IPR006563POX domain
PfamPF075262.1E-52366507IPR006563POX domain
PROSITE profilePS5007112.519557620IPR001356Homeobox domain
CDDcd000865.75E-13560621No hitNo description
SMARTSM003891.2E-9560624IPR001356Homeobox domain
SuperFamilySSF466893.08E-17561627IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28563626IPR009057Homeodomain-like
PfamPF059204.2E-18577616IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 820 aa     Download sequence    Send to blast
MGIATPPLPP ILKTHQSSVA PLIPSKSNSM SQDYHQAGIF SFSNGFERSQ VTHHQEHHQQ  60
QQHHLAQQIR RDKLRVQAGY GPPSEPLVGI EDEESGGLPV YETAGMLSEM FNFPPGGPVT  120
AAELLDQPLQ SNYRTAHPRQ QQPVTTNEWY SNNRQGMVGV LGPLGDSKNH NSRESLAQHH  180
QISGINADSA AAMQLFLMNP QPRSPSPAPS HPHHPPATSS TLHMLLPNPS TSLQGFSVSG  240
HGGAFGASSE ISPPQFTWVP GSANEGANTG AQLNNPVEIG SVVEGQGLSL SLSSSLQHLE  300
AAKAEELRMG ESGLLYYNQG GGSSSAAAQY YKNLGGQHQA LHLQAGVGQN HQVHVGFGSS  360
LGMVNVLRNS KYVKAAQELL EEFCSVGRGQ FKKNKYTRQN TNPSSNNPGG SSGGGSGGGG  420
GGGGSSSSTK DFPPLSASDR IEHQRRKVKL LSMLDEVDRR YNHYCEQMQM VVNSFDLVMG  480
FGAAVPYTAL AQKAMSRHFR CLKDAIAAQL KQSCELLGEK DGAGTSGITK GETPRLKLLE  540
QSLRQQRAFH QMGMMEQDAW RPQRGLPERS VNILRAWLFE HFLHPYPSDA DKHLLARQTG  600
LSRNQVSNWF INARVRLWKP MVEEMYQQEA KEDEDGGVDE DRERKQNNNS NNKSGVALAQ  660
TPTPTESSSA PSTTTTLPPA PVPAPAGKRS EITNENDPSI LAINRQCFSE NQAKHSPSTT  720
ATTIITPTTD QVAPPPSHAQ PFHDLTDETC RRGSNMVAAA EYGTTSVQHA NAGPDIGPTL  780
IRFGTTATAG DVSLTLGLRH AGNMPEKGSA FSFRDFGNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-16566623158Homeobox protein Meis1
4xrs_A1e-16566623158Homeobox protein Meis1
3k2a_B1e-16566624563Homeobox protein Meis2
3k2a_A1e-16566624563Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1411424SGGGSGGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079108.10.0PREDICTED: BEL1-like homeodomain protein 2 isoform X1
RefseqXP_012079109.10.0PREDICTED: BEL1-like homeodomain protein 2 isoform X1
SwissprotQ9SW801e-169BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A067KJ170.0A0A067KJ17_JATCU; Uncharacterized protein
STRINGPOPTR_0007s12170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-163BEL1-like homeodomain 2