PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G131000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 295aa    MW: 33771.2 Da    PI: 10.2055
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G131000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.92.1e-1410683597
                         EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3 35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                           tl+d +g  W+v+l  +k+ +  +++kGW+eF++ + L + Df+vFk+dg+s+f   vk++
  Manes.13G131000.1.p 10 NATLKDHTGMMWNVQL--EKTENDLIIKKGWQEFASHHSLVDADFLVFKYDGNSQF--SVKLY 68
                         689*************..**********************************9999..77765 PP

2B339.59.7e-131902611488
                          T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                   B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                            + + k+ +++h++k   + ++tl+de+g+ W vk+i+r  +gr+ +++GW +F   ++L  +D++vF+++ r+
  Manes.13G131000.1.p 190 YTVHIHKSVVKAHNIK--LQEKVTLRDENGQLWPVKIIFR-DDGRIGISEGWFNFRVKHKLAIKDMCVFEFMPRE 261
                          3456999999999877..5669***************765.556899***********************87554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.197171IPR003340B3 DNA binding domain
SMARTSM010190.013371IPR003340B3 DNA binding domain
CDDcd100178.63E-12968No hitNo description
Gene3DG3DSA:2.40.330.101.0E-14971IPR015300DNA-binding pseudobarrel domain
PfamPF023625.4E-121068IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-141072IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.39E-19174260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-19174261IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.25177274IPR003340B3 DNA binding domain
CDDcd100171.05E-14178261No hitNo description
SMARTSM010191.4E-6180268IPR003340B3 DNA binding domain
PfamPF023624.6E-11181262IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MQLNGFALKN ATLKDHTGMM WNVQLEKTEN DLIIKKGWQE FASHHSLVDA DFLVFKYDGN  60
SQFSVKLYGK NGLKKENTLP SKVSSTHMDE SETEEEKNRS PSTGGCKLKY SEMTSKENGR  120
QGRYGGSSKA AGSSGRRQYK FRQAAGSSRE RRRELRQNTV AKNEKCKLGR AYVTPENPHF  180
VTIMTRSTQY TVHIHKSVVK AHNIKLQEKV TLRDENGQLW PVKIIFRDDG RIGISEGWFN  240
FRVKHKLAIK DMCVFEFMPR EDNICNLIQV HTVQRNGEFD KKQAQPNTHV QSNE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.13G131000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021633728.10.0putative B3 domain-containing protein At5g66980
TrEMBLA0A2C9URG00.0A0A2C9URG0_MANES; Uncharacterized protein
STRINGcassava4.1_022865m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF143221518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.11e-28B3 family protein