PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G130800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family B3
Protein Properties Length: 284aa    MW: 32844.2 Da    PI: 10.8703
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G130800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.21.9e-1522951291
                         HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                   B3 12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91
                         ++  l +p  f+++++++   +k+ +l++e+g+ + v +  +  ++ry++++GW++Fvk+++L++gDf+vF l+++++fe
  Manes.13G130800.1.p 22 TK-KLAIPPLFIKTFKKN--IPKEPILKTEKGK-FLVSV--KFDDNRYFFKSGWNKFVKDHELETGDFLVFNLVDDKTFE 95
                         33.499******999755..7788999998885.77788..667778**************************9998885 PP

2B357.13.3e-181922721195
                          HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                   B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                          +++ +lv+p++f+++ g+++++     ++d++gr+ +v +  + + +++ l++GW+ F kangL +gD++vF+   +++    v+
  Manes.13G130800.1.p 192 NQKYILVIPRRFVDKTGLDSKR--NTLMKDPQGRVHTVDV--KVRNRQVRLSSGWSAFYKANGLATGDTCVFESLPEKGNLIEVQ 272
                          455679**********999655..57789***********..77777899***********************544444444555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.54710102IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-1812104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.16E-1812104IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.6E-1013102IPR003340B3 DNA binding domain
CDDcd100171.72E-131396No hitNo description
PfamPF023621.8E-132295IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-20178276IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-19178273IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.998182277IPR003340B3 DNA binding domain
SMARTSM010191.0E-7184277IPR003340B3 DNA binding domain
CDDcd100178.15E-15194275No hitNo description
PfamPF023621.4E-14196274IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MARKPKRNAG AKFFKILFGD FTKKLAIPPL FIKTFKKNIP KEPILKTEKG KFLVSVKFDD  60
NRYFFKSGWN KFVKDHELET GDFLVFNLVD DKTFEVDMYA PTCCLKSLKL AFHEKRSCKD  120
WEAKVTAEQE MLSKKRGRPR KPQVSARKAH GNAKRRPNVQ GNTETSQRER VAEAIRAIDP  180
KHPHFDMDLK HNQKYILVIP RRFVDKTGLD SKRNTLMKDP QGRVHTVDVK VRNRQVRLSS  240
GWSAFYKANG LATGDTCVFE SLPEKGNLIE VQIIKKRRQR ISH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.13G130800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021633619.10.0B3 domain-containing protein Os01g0723500-like
TrEMBLA0A2C9URJ60.0A0A2C9URJ6_MANES; Uncharacterized protein
STRINGcassava4.1_028119m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71851546
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.13e-20B3 family protein