PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G128100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 300aa    MW: 33184.2 Da    PI: 6.8986
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G128100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-4271061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC+++Cv+apyfp +qp+kfa vhk+FGasnv kll++l++++reda+ sl+yeA+ar+rdPvyG+vg+i+ lq++l++l
  Manes.13G128100.1.p   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFASVHKVFGASNVAKLLNELNTSQREDAVISLAYEADARLRDPVYGCVGLISILQHRLKEL 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+l  +k+e
  Manes.13G128100.1.p  97 QADLYNAKKE 106
                          ****998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.546107IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSTPNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFASVH KVFGASNVAK LLNELNTSQR  60
EDAVISLAYE ADARLRDPVY GCVGLISILQ HRLKELQADL YNAKKELAQY IGPQAMLPTL  120
QSSTFIPQTH LGNPTASSMM QHGALPIMGV PGPPTHGGQL VIREPQQQQQ QRHQSQIFEA  180
QQLAAAFAVR EHQDMFRAYE QQQEIVRFNR GFDAADSVTT TGFNQITVAS MSPSLALGSF  240
DTPYQVQPQQ VDHQLQAQLF LRPQQAQSQF HEQQQNSQQT QQHHQPSGSD EGGSIGPSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4851199124LOB family transfactor Ramosa2.1
5ly0_B2e-4851199124LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.13G128100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021632478.10.0LOB domain-containing protein 36-like
RefseqXP_021632479.10.0LOB domain-containing protein 36-like
SwissprotQ9FKZ39e-82LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A2C9URI90.0A0A2C9URI9_MANES; Uncharacterized protein
STRINGcassava4.1_025228m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-83ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]