PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G113100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRAS
Protein Properties Length: 465aa    MW: 51835.3 Da    PI: 5.764
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G113100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.34.7e-92554612373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fse 86 
                          ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl+  f++AL ar a+  s+++k l++ ++++ +    ++++++ +l  f++
  Manes.13G113100.1.p  55 EQLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTCAFLRALIARAAK--SGTCKLLAAMANAHCTlaiDTHKFSVIELagFVD 142
                          79****************************************************..6777777666666555433445555555589*** PP

                 GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelg 173
                          ++P+++f++ +aN aIlea+eg + vHi+D+++++++Q p+L++a+a+R e +p +++T+ g+ e        ++ee+g++L +fA++ +
  Manes.13G113100.1.p 143 LTPWHRFGFTAANAAILEAIEGYSSVHIVDLSMTHCMQVPTLIDAIANRFEVTPLIKLTVAGATEDIppmLDLSYEELGSKLINFARSRN 232
                          ***************************************************************776698888999*************** PP

                 GRAS 174 vpfefnvl...vakrledleleeLrvkp......gEalaVnlvlqlhrll......................desvsleserdevLklvk 232
                          v +ef+v+   +a+ +++l +e+Lrv++      gEal++n+++ lh+++                      ++s s++s r+ +Lk ++
  Manes.13G113100.1.p 233 VIMEFRVVpssYADGFSSL-IEQLRVQNmvyaesGEALVINCQMLLHYIPeetlfsinpstnssnpftfessSSSSSMSSLRTMFLKSLR 321
                          *******988866677777.88888888888889************************************9989999999********** PP

                 GRAS 233 slsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                          sl P+vvv+v++++d++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+n++a+eg +r+er e +++W +r+++a
  Manes.13G113100.1.p 322 SLDPTVVVLVDEDVDLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENIIAHEGLQRIERLEPKSRWVQRMRNA 410
                          ********************************************************.********************************* PP

                 GRAS 323 GFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                           F+++ + e+a++++k++l +++ ++g +  ee++ lvl+Wk++++v+++aW
  Manes.13G113100.1.p 411 NFRSICFCEDAVSEVKTMLGEHAaGWGLKK-EEDDHLVLTWKGHNVVFATAW 461
                          ***********************5555443.567889*************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.96728442IPR005202Transcription factor GRAS
PfamPF035141.6E-8955461IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MMQFTETPPP PLHQVTAPFS NPTMNKNQTQ RTRPWPGFPT SKALGSSFGD ANCMEQLLVH  60
CANAIESNDA TLAQQILWVL NNIAPPDGDS NQRLTCAFLR ALIARAAKSG TCKLLAAMAN  120
AHCTLAIDTH KFSVIELAGF VDLTPWHRFG FTAANAAILE AIEGYSSVHI VDLSMTHCMQ  180
VPTLIDAIAN RFEVTPLIKL TVAGATEDIP PMLDLSYEEL GSKLINFARS RNVIMEFRVV  240
PSSYADGFSS LIEQLRVQNM VYAESGEALV INCQMLLHYI PEETLFSINP STNSSNPFTF  300
ESSSSSSSMS SLRTMFLKSL RSLDPTVVVL VDEDVDLTSN NLVCRLRSAF NYLWIPYDTV  360
DTFLPRGSKQ RQWYEADICW KIENIIAHEG LQRIERLEPK SRWVQRMRNA NFRSICFCED  420
AVSEVKTMLG EHAAGWGLKK EEDDHLVLTW KGHNVVFATA WMSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B6e-464946182472Protein SHORT-ROOT
5b3h_B3e-465046129418Protein SHORT-ROOT
5b3h_E3e-465046129418Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.13G113100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021633662.10.0scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2C9UR270.0A0A2C9UR27_MANES; Uncharacterized protein
STRINGcassava4.1_029917m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-173GRAS family protein