PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G091600.1.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family EIL
Protein Properties Length: 484aa    MW: 55120.8 Da    PI: 4.8529
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G091600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          ++lkkrmwkd m++++lke++k      e+    ++s   +e++rrkkmsraQD+iLkYM+k+mevcnaqGfvYgi+pekgkpv+g+sds
                          79****************99997....455....3344569************************************************* PP

                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          Lr+WWke+v+fd+n+p ai++      +l++++    ++ s  h l++lqDTtlgSLLsalmq c ppqrrfple+g++pPWWPtG e+w
                          ********************983...35554444...589************************************************** PP

                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkq 270
                          wge+g+s+++g+ppykkphdlkkawkvsvL+avikhmsp+++++r+l+ qsk+lq km+akes ++++v+nqee +          l   
                          *************************************************************************9743........11..2 PP

                 EIN3 271 spkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                          ++ + ++ +++         + ++v  +    +++v++krk  ++++a+v +    + cq+ ++++se  l+f dkns+++++
                          22334444422........2223344445556899*****9877777777544...9***********************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.6E-11530269No hitNo description
Gene3DG3DSA:1.10.3180.104.3E-67145272IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.62E-59148271IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-561462721127Protein ETHYLENE INSENSITIVE 3
4zds_B2e-561462721127Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021632559.10.0putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX161e-134EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A2C9US900.0A0A2C9US90_MANES; Uncharacterized protein
STRINGXP_002533137.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-136EIL family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
  2. Jeong HJ,Choi JY,Shin HY,Bae JM,Shin JS
    Seed-specific expression of seven Arabidopsis promoters.
    Gene, 2014. 553(1): p. 17-23