PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.13G091500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family EIL
Protein Properties Length: 490aa    MW: 55497.2 Da    PI: 4.6996
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.13G091500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3381.51.2e-116303471353
                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          ++lkkrmwkd m++++lke+ k     +      ++s   +e++rrkkmsraQD+iLkYM+k mevcnaqGfvYgi pekgkp +g+sds
  Manes.13G091500.1.p  30 DDLKKRMWKDSMRMQKLKEKLKTD---EL-----HESLAKQEASRRKKMSRAQDSILKYMVKVMEVCNAQGFVYGILPEKGKPITGSSDS 111
                          79*************999988863...22.....2334568************************************************* PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          Lr+WWke+v+fd+n+p ai++      +l++++    ++ s  h l+++qDTtlgSLLsalmq c ppqrrfple+g++pPWWPtG e+w
  Manes.13G091500.1.p 112 LRQWWKEDVRFDQNAPLAITEFF---PLLEKHEV---DPVSCMHLLHDMQDTTLGSLLSALMQRCIPPQRRFPLERGLAPPWWPTGGEAW 195
                          ********************983...35554444...589************************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXX CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkq 270
                          wge+g+s+++g+ppykkphdlkkawk+s L+avikhmsp+++ +r+l  qsk+lq km+akes+++++v+nqee + +            
  Manes.13G091500.1.p 196 WGEQGASQEHGAPPYKKPHDLKKAWKLSALAAVIKHMSPNFDSMRRLLTQSKCLQAKMTAKESATWSKVVNQEETLSK----------LM 275
                          *************************************************************************97442..........12 PP

                          XXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
                 EIN3 271 spkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                          ++ + ++ +++ d +   es ++h        +++v++krk  ++++a+v  k  ++ cq+ ++++se  l+f dkns+++++
  Manes.13G091500.1.p 276 QTCLRIDAGEE-DHD---ESVTHHFG----SYDLQVNEKRKCTFEREASVD-K--VYACQNLECPQSEEGLGFLDKNSRTDHQ 347
                          33445555533.332...33323343....347899999996666666653.4..5************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.8E-11130269No hitNo description
Gene3DG3DSA:1.10.3180.103.0E-64145274IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.06E-56148271IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MVKFHGEEDV DLPISFQEGG SEDEDEISYD DLKKRMWKDS MRMQKLKEKL KTDELHESLA  60
KQEASRRKKM SRAQDSILKY MVKVMEVCNA QGFVYGILPE KGKPITGSSD SLRQWWKEDV  120
RFDQNAPLAI TEFFPLLEKH EVDPVSCMHL LHDMQDTTLG SLLSALMQRC IPPQRRFPLE  180
RGLAPPWWPT GGEAWWGEQG ASQEHGAPPY KKPHDLKKAW KLSALAAVIK HMSPNFDSMR  240
RLLTQSKCLQ AKMTAKESAT WSKVVNQEET LSKLMQTCLR IDAGEEDHDE SVTHHFGSYD  300
LQVNEKRKCT FEREASVDKV YACQNLECPQ SEEGLGFLDK NSRTDHQVTC AYRLKEIDSS  360
SSQENSDGNF SDSSTSLLPF YDQPLISPGS ITAAMDNNRD LLSVIDWANT DIDPKGDQSV  420
AEIGEESAGF KMVEDYLNFG GTGIEDYPNL WDTGTEQRQT ENMGMNKKTV PENPDDQGII  480
TSIWDLGFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A7e-551462731128Protein ETHYLENE INSENSITIVE 3
4zds_B7e-551462731128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.13G091500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021632558.10.0putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9FJQ51e-131EIL5_ARATH; ETHYLENE INSENSITIVE 3-like 5 protein
TrEMBLA0A2C9UQ930.0A0A2C9UQ93_MANES; Uncharacterized protein
STRINGXP_002533137.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-126EIL family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]