PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G156800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NAC
Protein Properties Length: 201aa    MW: 23224 Da    PI: 4.5435
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G156800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.85.6e-3391281128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrF Ptd+el+ ++L +k++  + +   +i+  d++ ++Pw+L+ k+ ++ ++wyfF++  + +     ++++t++g+Wk+   +k
  Manes.12G156800.1.p   9 LPPGFRFCPTDQELILHFLYRKASLLPSHD--IIP--DLHPLDPWNLHGKALSSGNHWYFFTQMMEFE----SQQQVTENGVWKKLDVQK 90 
                          79*********************9999544..676..68999*****977778899*******99876....4678999*********** PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++s +g+++g+k+ Lv+y g+ p++ +t+W+mh+y+l
  Manes.12G156800.1.p  91 PIFSDSGNKIGIKNYLVYYIGQPPTAIETNWIMHQYHL 128
                          ************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-396152IPR003441NAC domain
PROSITE profilePS5100537.4399153IPR003441NAC domain
PfamPF023652.0E-2110128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGDYSSLKLP PGFRFCPTDQ ELILHFLYRK ASLLPSHDII PDLHPLDPWN LHGKALSSGN  60
HWYFFTQMME FESQQQVTEN GVWKKLDVQK PIFSDSGNKI GIKNYLVYYI GQPPTAIETN  120
WIMHQYHLCN SSSPKRIRKS DYHKWVLCRV YQSVENSGKS LNCRDDDEDE DDDDDGTELS  180
CLDEMFLSLE DDLDDISLPN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-32515916174NAC domain-containing protein 19
3swm_B4e-32515916174NAC domain-containing protein 19
3swm_C4e-32515916174NAC domain-containing protein 19
3swm_D4e-32515916174NAC domain-containing protein 19
3swp_A4e-32515916174NAC domain-containing protein 19
3swp_B4e-32515916174NAC domain-containing protein 19
3swp_C4e-32515916174NAC domain-containing protein 19
3swp_D4e-32515916174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.12G156800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR6051760.0KR605176.1 Manihot esculenta NAC transcription factors 38 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021630092.11e-148NAC domain-containing protein 104-like
SwissprotQ8GWK67e-55NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0M4FLP91e-147A0A0M4FLP9_MANES; NAC transcription factors 38
STRINGcassava4.1_016624m1e-148(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-47xylem NAC domain 1
Publications ? help Back to Top
  1. Hu W, et al.
    Genome-Wide Identification and Expression Analysis of the NAC Transcription Factor Family in Cassava.
    PLoS ONE, 2015. 10(8): p. e0136993
    [PMID:26317631]
  2. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  3. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]