PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G134300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family CAMTA
Protein Properties Length: 1080aa    MW: 120906 Da    PI: 6.4103
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G134300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-11759.9e-55201362118
                 CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseen 91 
                          ++ ++rwl++ ei++iL n+++++++ e+++rp+sgsl+L++rk +ryfrkDG++w+kkkdgktv+E+hekLK g+v+vl+cyYah+e n
  Manes.12G134300.1.p  20 VEARHRWLRPAEICEILRNYKQFRVAPEPQHRPPSGSLLLFDRKALRYFRKDGHNWRKKKDGKTVKEAHEKLKSGSVDVLHCYYAHGEGN 109
                          6779************************************************************************************** PP

                 CG-1  92 ptfqrrcywlLeeelekivlvhylevk 118
                          ++fqrr+yw+Leeel++ivlvhy++vk
  Manes.12G134300.1.p 110 ENFQRRSYWMLEEELSHIVLVHYRDVK 136
                          ************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143779.78815141IPR005559CG-1 DNA-binding domain
SMARTSM010762.9E-7618136IPR005559CG-1 DNA-binding domain
PfamPF038598.7E-4921135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.108.2E-6498585IPR013783Immunoglobulin-like fold
SuperFamilySSF812965.6E-17499585IPR014756Immunoglobulin E-set
PfamPF018331.3E-5499578IPR002909IPT domain
SuperFamilySSF484031.2E-14675791IPR020683Ankyrin repeat-containing domain
CDDcd002041.40E-11680789No hitNo description
Gene3DG3DSA:1.25.40.208.2E-16687792IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029715.486697801IPR020683Ankyrin repeat-containing domain
PfamPF127964.1E-6702793IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500888.549730762IPR002110Ankyrin repeat
SMARTSM002480.12730759IPR002110Ankyrin repeat
SMARTSM002481100769798IPR002110Ankyrin repeat
SuperFamilySSF525405.58E-8898955IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001511904926IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.181906934IPR000048IQ motif, EF-hand binding site
PfamPF006120.031906925IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0039927949IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.578928952IPR000048IQ motif, EF-hand binding site
PfamPF006122.2E-4930949IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1080 aa     Download sequence    Send to blast
MAEARSSPIG NQLDILQILV EARHRWLRPA EICEILRNYK QFRVAPEPQH RPPSGSLLLF  60
DRKALRYFRK DGHNWRKKKD GKTVKEAHEK LKSGSVDVLH CYYAHGEGNE NFQRRSYWML  120
EEELSHIVLV HYRDVKGNRA NFNNVKEHED TIPCTQEIED TVPHSEMDTS VSSHFHHDNY  180
QVPAQTADTI SMNSAQASEY EDAESVYNHQ ASSGLHLFLE EQQPAREKID ASLRDHHDPV  240
SLSSGYEGKL SAVPGRDFFS LAHADKAEDT EGASSTFQLQ KHFDLPCWKD ILENFTPGIE  300
SASFRPQFSS QGDTAGIIPK QEDAIPKQLL SNSLPLQKEW QNLEDASSRL SKWAMDQKLH  360
PNSTADLTTS FHEQELLSGD LTNTLELFGT QKSGHSVQND VQLQYSNTDQ SITPEGKSIY  420
SSTVKQLSEE GLKKLDSFSR WMSKELGDVN ESHMQSSSGP YWDAVENENG IDDPKISSRV  480
HLDTYLLGPS LSQDQLFSII DFSPTWVYVG SKIKVLITGR FLKTPEEVEN CKWSCMFGEV  540
EVQAEVIADG VLRCQTPLNK AGMVPFYVTC SDRVACSEVR EFEYRLSQDV NIIDSYSSSS  600
SVMRFGKLLS LNSLSLPKCN TSNIVENTQL SNKISSLLKV HNEEEWNKML KLTSEAGVSL  660
EKVKEELLQK LLKDRLHVWL LQKAAEGGKG PSVLDEGGQG VLHLAAALGY DWALEPTIVA  720
GVSVNFRDIN GWTALHWAAS CGRERTVASL VFLGAAPGAL TDPTPKYPTA RTPADLASAN  780
GHKGIAGYLA ESALSAHLFS LNLDKQDGDV AGVPEAKAGQ IVPEHSTSVN SDGDLPYGLS  840
LKDSLAAVYN ATQAAARIHQ VFRVQSFQKK QLKEFGDDKY GMPHEHALSF IASKALKSGQ  900
HDEPVHAAAT RIQNKFRSWK GRKEFLIIRQ RIVKIQAHVR GHQVRKNYRK IVWSVGIVEK  960
VILRWRRKGS GLRGFKSEAL IGGPSMQDRS PKEDDYDFFK EGRKQTEARS QIALARVKSM  1020
HQYPEARDQY RRLLNVVTEI QETKLVGDQI NNSEATAEFD DLIDVEALFD DDTFMPAAS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088869.10.0PREDICTED: calmodulin-binding transcription activator 3
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLA0A067LHJ40.0A0A067LHJ4_JATCU; Uncharacterized protein
STRINGPOPTR_0007s05410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82842735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1