PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G110800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRAS
Protein Properties Length: 459aa    MW: 51097.5 Da    PI: 5.6209
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G110800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS297.33.9e-91574552373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fse 86 
                          ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl+  f++AL ar a+  ++++k l++ ++++ +    ++++++ +l  f++
  Manes.12G110800.1.p  57 EQLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTCAFLRALVARAAK--NGTCKLLAAMANANCTlaiNTHKFSVIELagFVD 144
                          79****************************************************..6666666666655544444555556666689*** PP

                 GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelg 173
                          ++P+++f++ +aN aI ea++g + vHi+D++++ ++Q p+L++a+a+R e +p +++T+ g+ e        ++ e+g +L +fA++ +
  Manes.12G110800.1.p 145 LTPWHRFGFTAANAAIIEAIDGYSSVHIVDLSMTRCMQIPTLIDAIANRFEVTPLIKLTVAGATEDIppmLDLSYDELGAKLINFARSRN 234
                          ***************************************************************7766987888999************** PP

                 GRAS 174 vpfefnvl...vakrledleleeLrvkp......gEalaVnlvlqlhrll...............desvsleserdevLklvkslsPkvv 239
                          v +ef+v+   +a+ +++l +e+Lrv++      gEal+Vn+++ lh+++                 sv  +s r+ +Lk ++sl P++v
  Manes.12G110800.1.p 235 VIMEFRVVhssYADGFSSL-IEQLRVQNlvytenGEALVVNCQMLLHYIPeetisssiprtnssnPYSVVESSLRTMFLKSLWSLDPTIV 323
                          *******966633344444.66666666666669****************99999999999986533444444899************** PP

                 GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpl 329
                          v+v+++ad+ s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r+er et++ W +r+++a F+++++
  Manes.12G110800.1.p 324 VLVDEDADLISNNLVCRLRSAFNYLWIPYDTMDTFLPRGSKQRQWYEAD-ICWKIENVIAHEGLQRVERLETKSMWVQRMKNANFRSISF 412
                          *************************************************.**************************************** PP

                 GRAS 330 sekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          +e+a++++k++l +++  g+ +++e++ lvl+Wk++++v+++aW
  Manes.12G110800.1.p 413 GEDAVSEVKTMLGEHA-AGWGLKKEEDDLVLTWKGHNVVFATAW 455
                          ****************.8999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.06730437IPR005202Transcription factor GRAS
PfamPF035141.3E-8857455IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MQFTETPPPP LQFHGQITAP ISNPTVNKIN QTQRTRPWPG FPTSKALGSL GDANCMEQLL  60
VHCANAIESN DATLAQQILW VLNNIAPPDG DSNQRLTCAF LRALVARAAK NGTCKLLAAM  120
ANANCTLAIN THKFSVIELA GFVDLTPWHR FGFTAANAAI IEAIDGYSSV HIVDLSMTRC  180
MQIPTLIDAI ANRFEVTPLI KLTVAGATED IPPMLDLSYD ELGAKLINFA RSRNVIMEFR  240
VVHSSYADGF SSLIEQLRVQ NLVYTENGEA LVVNCQMLLH YIPEETISSS IPRTNSSNPY  300
SVVESSLRTM FLKSLWSLDP TIVVLVDEDA DLISNNLVCR LRSAFNYLWI PYDTMDTFLP  360
RGSKQRQWYE ADICWKIENV IAHEGLQRVE RLETKSMWVQ RMKNANFRSI SFGEDAVSEV  420
KTMLGEHAAG WGLKKEEDDL VLTWKGHNVV FATAWMSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B4e-475145582472Protein SHORT-ROOT
5b3h_B1e-475145528418Protein SHORT-ROOT
5b3h_E1e-475145528418Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.12G110800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021629235.10.0scarecrow-like protein 32
SwissprotQ9SN221e-178SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2C9UX090.0A0A2C9UX09_MANES; Uncharacterized protein
STRINGXP_002525254.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-180GRAS family protein