PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G096500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 814aa    MW: 88039.5 Da    PI: 6.6951
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G096500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-095826191954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Manes.12G096500.1.p 582 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 619
                          664459******************************88 PP

2BELL121.73.2e-39442513172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +r e+q++k+kLl +l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdaia q+
  Manes.12G096500.1.p 442 DRIEHQRRKVKLLFMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAVPYTALAQKAMSRHFRCLKDAIAAQL 513
                          589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.5E-82367511IPR006563POX domain
PfamPF075262.5E-51372510IPR006563POX domain
PROSITE profilePS5007112.568560623IPR001356Homeobox domain
SMARTSM003891.2E-9563627IPR001356Homeobox domain
CDDcd000863.42E-13563624No hitNo description
SuperFamilySSF466893.89E-17565630IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-29566629IPR009057Homeodomain-like
PfamPF059204.2E-18580619IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MGIATPPLPP ILSHSKIHQS VAPLIPHNSD SANYSMSQDY HQAAGIFSFS NGFERSQVAH  60
QEHHQQQQHH FAHQIHRDKL RVQGGYGPSP GPLVGIEEEE SSGLPVYETA GMLSEMFNFP  120
PGGQANAAEL LDQPLQSNYR TAHHPRQQQS VTTSEWYSNN RQGMVGGLGP LGDKNHTTRD  180
SLAHHHQISG INADSAASMQ LFLTNPQPRS PSPAPSHPHN PPATSSTLHM LLPNPSSSLQ  240
GFSMSGPGGD FGTSNEISPQ HFTWVPDSAH AGTNTGAQLT NPSEIGSVVE GQGLSLSLSS  300
SLQHLEAAKA EELRMGDGGL LYYNQAGGSS SGAAQYYKNL GSQHQALHLQ AGVGQNHQVH  360
VGFGSSLGVV NVLRNSKYVK AVQELLEEFC SVGRGQFKKN KFSRQNTNPS CNNPGVSSGG  420
GSGGGGGSSS STKDLPTLSA ADRIEHQRRK VKLLFMLDEV DRRYNHYCEQ MQMVVNSFDL  480
VMGFGAAVPY TALAQKAMSR HFRCLKDAIA AQLKHSCELL GEKDGAGTSG ITKGETPRLK  540
LLEQSLRQQR AFHQMGMMEQ EAWRPQRGLP ERSVNILRAW LFEHFLHPYP SDADKHLLAR  600
QTGLSRNQVS NWFINARVRL WKPMVEEMYQ QEAKEEEEEE EEEEGAVEDR EIKQTNNNNG  660
VAQTPTPTPT ASSSAPPTTT TPPPPPPAGG KRSENANEND PSLLAINTQC SSEHQAKHSP  720
STTATTFITP TTELAPPSFH DLADETCRRG SLVPAEYGTT SAHHANAEPD IGSTLIRFGT  780
TAAGDVSLTL GLRHAGNMPD KGSAFSVRDF GNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16569627563Homeobox protein Meis2
3k2a_B1e-16569627563Homeobox protein Meis2
4xrm_A1e-16569627563Homeobox protein Meis2
4xrm_B1e-16569627563Homeobox protein Meis2
4xrs_A1e-16569626158Homeobox protein Meis1
4xrs_B1e-16569626158Homeobox protein Meis1
5bng_A1e-16569627159Homeobox protein Meis2
5bng_B1e-16569627159Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079108.10.0PREDICTED: BEL1-like homeodomain protein 2 isoform X1
RefseqXP_012079109.10.0PREDICTED: BEL1-like homeodomain protein 2 isoform X1
SwissprotQ94KL51e-162BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLA0A067KJ170.0A0A067KJ17_JATCU; Uncharacterized protein
STRINGPOPTR_0007s12170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-153BEL1-like homeodomain 2