PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G092900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family VOZ
Protein Properties Length: 471aa    MW: 52213.2 Da    PI: 5.254
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G092900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4441.8e-1362064221217
                  VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                          ppp+af+gp+calwdctrpaqgsew++dycs+fhatlalneg+pg+tpvlrp+gi+lkd++lf+al+ak+qgk+vgip+cegaa++kspw
  Manes.12G092900.1.p 206 PPPAAFMGPQCALWDCTRPAQGSEWFADYCSNFHATLALNEGPPGMTPVLRPWGISLKDNSLFNALTAKKQGKNVGIPQCEGAASMKSPW 295
                          89**************************************************************************************** PP

                  VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldal 180
                          naaelfdl+ll+getirewlffdkprrafesg+rkqrslpdy+grgwhesrkqvmkefgg+krsyymdpqp++++ewhlyeye+n++d++
  Manes.12G092900.1.p 296 NAAELFDLRLLDGETIREWLFFDKPRRAFESGSRKQRSLPDYRGRGWHESRKQVMKEFGGQKRSYYMDPQPPGCYEWHLYEYEVNNYDEC 385
                          ****************************************************************************************** PP

                  VOZ 181 alyrlelklvdekksakgkvskdsladlqkklgrlta 217
                          alyrle+klvdekk+++gkv+kdsladlqkk+g+lta
  Manes.12G092900.1.p 386 ALYRLEVKLVDEKKTPRGKVMKDSLADLQKKMGKLTA 422
                          ***********************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MQKNAKSKCA SSSHHLFVDN AKNRLNDLQE RFSNLQAAIK DGRVSDVAIL EEQVYQSLRE  60
WKADLDAPSP ASSVLGGSLG TFSDDIGRLL KLCEEEDDAT SALAEQSVLK PEPTDQNLNI  120
GHFTAFEDGC LPNSDSQIHN FQGFDQSNSS ALALQDMVVS TSDMNTFLDC HHFILDEGFN  180
HGLSFGYTDG KELGKSAEMN NLPINPPPAA FMGPQCALWD CTRPAQGSEW FADYCSNFHA  240
TLALNEGPPG MTPVLRPWGI SLKDNSLFNA LTAKKQGKNV GIPQCEGAAS MKSPWNAAEL  300
FDLRLLDGET IREWLFFDKP RRAFESGSRK QRSLPDYRGR GWHESRKQVM KEFGGQKRSY  360
YMDPQPPGCY EWHLYEYEVN NYDECALYRL EVKLVDEKKT PRGKVMKDSL ADLQKKMGKL  420
TADTSDSSPS TKGRTKVDGK TKAEDVDSSE DHKTTGAGSV GCDSIQWSSK *
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.12G092900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021631308.10.0transcription factor VOZ1-like
RefseqXP_021631309.10.0transcription factor VOZ1-like
SwissprotQ9SGQ01e-171VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A251JN440.0A0A251JN44_MANES; Uncharacterized protein
STRINGcassava4.1_030824m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-173vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]