PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G131800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 209aa    MW: 24085.3 Da    PI: 9.6993
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G131800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.42.1e-1211472557
                         --HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox 25 psaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         p ++++++++++l    +++e++V++WFqNr+a++++
  Manes.11G131800.1.p 11 PGRTQIQQITSRLkqygHIEEKNVFYWFQNRKARQRQ 47
                         8899*******************************97 PP

2Wus_type_Homeobox69.36.7e-238492465
    Wus_type_Homeobox 24 lrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         +  P + +iq+it++L++yG+ie+kNVfyWFQNrkaR+rqkq
  Manes.11G131800.1.p  8 MAGPGRTQIQQITSRLKQYGHIEEKNVFYWFQNRKARQRQKQ 49
                         6789************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.928148IPR001356Homeobox domain
CDDcd000860.004331149No hitNo description
PfamPF000465.4E-101147IPR001356Homeobox domain
SuperFamilySSF466892.8E-81154IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-61455IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MKSETMDMAG PGRTQIQQIT SRLKQYGHIE EKNVFYWFQN RKARQRQKQK QENTAYINRY  60
LHKAYQPVFS PLCSNVICGS YYLPRRDLGF YLRYPKVLLP NGFKRRPRSE KIDKARAYAF  120
TDSKQETIDD KFFGNNEETL PLFLLHPTGV LQGRAETLRS LGSMICAAEN SIANSASSSS  180
EMTTGVEDVS SDKPFFDIYF FFHETNAK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.11G131800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021682189.12e-88WUSCHEL-related homeobox 2-like
TrEMBLA0A2C9V2I91e-156A0A2C9V2I9_MANES; Uncharacterized protein
STRINGcassava4.1_021403m1e-136(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.18e-18WUSCHEL related homeobox 2