PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G100100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NAC
Protein Properties Length: 194aa    MW: 21931.5 Da    PI: 4.6277
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G100100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM123.81.4e-3881261128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrF Pt+eelvv++L++k++  +++  +vi+++d+y ++Pw+L+ k+ ae k+wyf+s+r         +nr+t++gyW+ tg ++
  Manes.11G100100.1.p   8 LPPGFRFYPTEEELVVHFLQRKAALLPCHP-DVIPDLDLYPYDPWQLDGKALAEGKQWYFYSRRT--------QNRITENGYWNPTGIEE 88 
                          79*************************999.99**************97777889*******984........589************** PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +v+++ +++vg+kk L fy g+ap g kt+W+m+eyrl
  Manes.11G100100.1.p  89 SVVTSANRTVGMKKCLGFYIGEAPAGMKTSWIMEEYRL 126
                          ************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-475160IPR003441NAC domain
PROSITE profilePS5100545.3078161IPR003441NAC domain
PfamPF023651.7E-229126IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MSGGNVSLPP GFRFYPTEEE LVVHFLQRKA ALLPCHPDVI PDLDLYPYDP WQLDGKALAE  60
GKQWYFYSRR TQNRITENGY WNPTGIEESV VTSANRTVGM KKCLGFYIGE APAGMKTSWI  120
MEEYRLLSSD SSSSSRRKSS KTRANPKTDH SKWVICKVYE RSCDEDDDDG AELSCLDEVF  180
LSLDDLDEIS LPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-42516214166NO APICAL MERISTEM PROTEIN
1ut4_B2e-42516214166NO APICAL MERISTEM PROTEIN
1ut7_A2e-42516214166NO APICAL MERISTEM PROTEIN
1ut7_B2e-42516214166NO APICAL MERISTEM PROTEIN
3swm_A3e-42516217169NAC domain-containing protein 19
3swm_B3e-42516217169NAC domain-containing protein 19
3swm_C3e-42516217169NAC domain-containing protein 19
3swm_D3e-42516217169NAC domain-containing protein 19
3swp_A3e-42516217169NAC domain-containing protein 19
3swp_B3e-42516217169NAC domain-containing protein 19
3swp_C3e-42516217169NAC domain-containing protein 19
3swp_D3e-42516217169NAC domain-containing protein 19
4dul_A2e-42516214166NAC domain-containing protein 19
4dul_B2e-42516214166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.11G100100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021627814.11e-143NAC domain-containing protein 104
SwissprotQ8GWK63e-80NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A2C9V1A31e-142A0A2C9V1A3_MANES; Uncharacterized protein
STRINGcassava4.1_032971m1e-107(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.16e-81xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]