PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G087500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SRS
Protein Properties Length: 214aa    MW: 23049 Da    PI: 8.7138
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G087500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702189.41.4e-58121536154
               DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssae 95 
                          ++CqdCGnqakk+C ++RCRtCCks+gf+C+thv+stW+pa++rr r q l+++ ++aaa+  + ++ ++ +       + + ++l ++ 
  Manes.11G087500.1.p  12 SRCQDCGNQAKKECIYMRCRTCCKSKGFQCETHVRSTWIPAYRRRRRPQSLSSSCATAAAAVLAMQQ-QHSS------DQHNPKRLRENP 94 
                          68*********************************************99888876666554333222.2222......223333444455 PP

               DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                           +  le+ ++P++v+s a frc rvss d++e+++ Yqt+v+igGh+fkGiLydqG+ee
  Manes.11G087500.1.p  95 LTAGLEVGNFPAQVNSIATFRCFRVSSADKAEDQFVYQTSVNIGGHIFKGILYDQGPEE 153
                          56679999*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.5E-5511152IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.5E-281455IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.7E-23104151IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MMMREGGLLC GSRCQDCGNQ AKKECIYMRC RTCCKSKGFQ CETHVRSTWI PAYRRRRRPQ  60
SLSSSCATAA AAVLAMQQQH SSDQHNPKRL RENPLTAGLE VGNFPAQVNS IATFRCFRVS  120
SADKAEDQFV YQTSVNIGGH IFKGILYDQG PEESSSGHLQ DPNLTNAGGA LSTATAALAS  180
TSSSVAADSL AASYTFPLNA FISGTQLFLH PKS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.11G087500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021627107.11e-159protein SHI RELATED SEQUENCE 1-like
TrEMBLA0A2C9V0V61e-158A0A2C9V0V6_MANES; Uncharacterized protein
STRINGcassava4.1_021477m1e-159(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99692541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.11e-47Lateral root primordium (LRP) protein-related