PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G022300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family NF-YA
Protein Properties Length: 284aa    MW: 31116.7 Da    PI: 7.5568
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G022300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.29.9e-32125181158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          dep++VNaKQy++Il+RR  Rakle+++kl +ksrkpylheSRh hAlrR+RgsgGrF
  Manes.11G022300.1.p 125 DEPIFVNAKQYNAILRRRRYRAKLEAQNKL-IKSRKPYLHESRHLHALRRARGSGGRF 181
                          79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-36123184IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.636124184IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.7E-27126181IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.5E-22127149IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860129149IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.5E-22158181IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGVLQQNFHG AKKLTFQFQD QDSSSTQSTD QSYPEVASMG EGLAETLGKA EGGDTKLATS  60
MGTQDFIFPS QVDYSQSIGR IPFHFAEPYF GGLLAAYGPQ AIIHHPQMYG MASSRVPLPL  120
EFTEDEPIFV NAKQYNAILR RRRYRAKLEA QNKLIKSRKP YLHESRHLHA LRRARGSGGR  180
FLNAKQLQES NPKLSSHGLD ATGSAELHLA GNMSESEIHQ PENHRDGAST TSCSDITSAS  240
NSDDIFQQPE FKFSGYPSHV VGTMQGRSVG MHGGGSQHHL PVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-19125186263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapManes.11G022300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021627181.10.0nuclear transcription factor Y subunit A-3 isoform X2
SwissprotQ93ZH21e-72NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A2C9UXL50.0A0A2C9UXL5_MANES; Uncharacterized protein
STRINGcassava4.1_013364m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101202541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-71nuclear factor Y, subunit A3